Citrus Sinensis ID: 015145
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 412 | ||||||
| 224124910 | 507 | predicted protein [Populus trichocarpa] | 0.929 | 0.755 | 0.704 | 1e-166 | |
| 294440430 | 506 | aspartic protease 1 [Nicotiana tabacum] | 0.927 | 0.754 | 0.703 | 1e-165 | |
| 171854659 | 506 | putative aspartic protease [Capsicum chi | 0.929 | 0.756 | 0.698 | 1e-164 | |
| 12231178 | 505 | aspartic proteinase 4 [Nepenthes alata] | 0.927 | 0.756 | 0.712 | 1e-162 | |
| 82623417 | 506 | aspartic protease precursor-like [Solanu | 0.927 | 0.754 | 0.692 | 1e-161 | |
| 418731269 | 372 | aspartic protease, partial [Solanum tube | 0.890 | 0.986 | 0.715 | 1e-161 | |
| 350535356 | 506 | aspartic protease precursor [Solanum lyc | 0.927 | 0.754 | 0.687 | 1e-160 | |
| 50540937 | 497 | Asp [Solanum tuberosum] | 0.895 | 0.742 | 0.703 | 1e-158 | |
| 114786427 | 508 | aspartic protease [Ipomoea batatas] | 0.924 | 0.75 | 0.698 | 1e-158 | |
| 356534977 | 508 | PREDICTED: aspartic proteinase-like [Gly | 0.890 | 0.722 | 0.718 | 1e-158 |
| >gi|224124910|ref|XP_002319454.1| predicted protein [Populus trichocarpa] gi|222857830|gb|EEE95377.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 592 bits (1526), Expect = e-166, Method: Compositional matrix adjust.
Identities = 272/386 (70%), Positives = 332/386 (86%), Gaps = 3/386 (0%)
Query: 30 FHLQSAISLFPAISIRGKSCEINYGSGSISGFFSQDNVEVGDVVVKDQVFIEATREGSLT 89
FH + S + G CEI+YGSGS+SGFFSQDNV+VGD+VVKDQVF+EAT+EGSL+
Sbjct: 122 FHSKYKSSRSSTYTKNGNFCEIHYGSGSVSGFFSQDNVQVGDLVVKDQVFVEATKEGSLS 181
Query: 90 FLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGG 149
F+L +FDGI+GLGF+EI+VG+ VP+W NM++Q LV +EVFSFWLNR+P+A+EGGE+VFGG
Sbjct: 182 FILGKFDGILGLGFQEISVGNVVPLWYNMIQQDLVDDEVFSFWLNRNPEAKEGGELVFGG 241
Query: 150 VDPKHFKGKHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVV 209
VDPKHFKGKHTYVPVT+KGYWQ +GD LIG STG+CEGGCAAIVDSGTSLLAGPTP++
Sbjct: 242 VDPKHFKGKHTYVPVTQKGYWQINMGDFLIGKHSTGLCEGGCAAIVDSGTSLLAGPTPII 301
Query: 210 TEINHAIGGEGVVSAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGI 269
TEINHAIG EG+VSAECK VVS YGDLIW+L++SG+ P KVC Q+GLC FN A+ TGI
Sbjct: 302 TEINHAIGAEGLVSAECKEVVSHYGDLIWELIISGVQPSKVCTQLGLCIFNEAKSARTGI 361
Query: 270 KTVVEKEN---VSAGDSAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGE 326
++VVEKEN SAG+ C+AC+M V+WVQNQL++K TKE ++Y+++LC+SLP+PMG+
Sbjct: 362 ESVVEKENKEKSSAGNDLPCTACQMLVIWVQNQLREKATKETAINYLDKLCESLPSPMGQ 421
Query: 327 SIIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWI 386
S IDC+ I TMPN++FTIGDK F+L+PEQYILKTGEGIA+VCISGFMA D+PPPRGPLWI
Sbjct: 422 SSIDCNSISTMPNITFTIGDKPFSLTPEQYILKTGEGIAQVCISGFMALDVPPPRGPLWI 481
Query: 387 LGDVFMGVYHTVFDSGKLRIGFAEAA 412
LGDVFMG YHT+FD G L +GFAEAA
Sbjct: 482 LGDVFMGAYHTIFDYGNLEVGFAEAA 507
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|294440430|gb|ADE74632.1| aspartic protease 1 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|171854659|dbj|BAG16519.1| putative aspartic protease [Capsicum chinense] | Back alignment and taxonomy information |
|---|
| >gi|12231178|dbj|BAB20972.1| aspartic proteinase 4 [Nepenthes alata] | Back alignment and taxonomy information |
|---|
| >gi|82623417|gb|ABB87123.1| aspartic protease precursor-like [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|418731269|gb|AFX67029.1| aspartic protease, partial [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|350535356|ref|NP_001234702.1| aspartic protease precursor [Solanum lycopersicum] gi|951449|gb|AAB18280.1| aspartic protease precursor [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|50540937|gb|AAT77954.1| Asp [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|114786427|gb|ABI78942.1| aspartic protease [Ipomoea batatas] | Back alignment and taxonomy information |
|---|
| >gi|356534977|ref|XP_003536026.1| PREDICTED: aspartic proteinase-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 412 | ||||||
| UNIPROTKB|B9RXH6 | 511 | RCOM_0903730 "Aspartic protein | 0.890 | 0.718 | 0.648 | 1.1e-133 | |
| TAIR|locus:2008940 | 506 | APA1 "aspartic proteinase A1" | 0.888 | 0.723 | 0.633 | 2.1e-132 | |
| TAIR|locus:2018037 | 513 | AT1G62290 [Arabidopsis thalian | 0.927 | 0.744 | 0.605 | 6.6e-129 | |
| TAIR|locus:2137189 | 508 | AT4G04460 [Arabidopsis thalian | 0.929 | 0.753 | 0.561 | 1.1e-119 | |
| WB|WBGene00000217 | 444 | asp-4 [Caenorhabditis elegans | 0.432 | 0.400 | 0.455 | 5.4e-65 | |
| RGD|61940 | 420 | Napsa "napsin A aspartic pepti | 0.461 | 0.452 | 0.408 | 6.9e-59 | |
| DICTYBASE|DDB_G0279411 | 383 | ctsD "cathepsin D" [Dictyostel | 0.441 | 0.475 | 0.455 | 6.1e-58 | |
| UNIPROTKB|E2RJN2 | 396 | CTSE "Uncharacterized protein" | 0.444 | 0.462 | 0.417 | 1.4e-54 | |
| FB|FBgn0033933 | 404 | CG10104 [Drosophila melanogast | 0.417 | 0.425 | 0.4 | 1.8e-54 | |
| UNIPROTKB|P43159 | 396 | CTSE "Cathepsin E" [Oryctolagu | 0.512 | 0.532 | 0.378 | 6.1e-54 |
| UNIPROTKB|B9RXH6 RCOM_0903730 "Aspartic proteinase, putative" [Ricinus communis (taxid:3988)] | Back alignment and assigned GO terms |
|---|
Score = 1310 (466.2 bits), Expect = 1.1e-133, P = 1.1e-133
Identities = 240/370 (64%), Positives = 294/370 (79%)
Query: 46 GKSCEINYGSGSISGFFSQXXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFRE 105
GKS EI+YGSG+ISGFFS FIEAT+E +TF+ A+FDGI+GLGF+E
Sbjct: 142 GKSAEIHYGSGAISGFFSSDNVVVGNLVVKDQEFIEATKEPGVTFVAAKFDGILGLGFQE 201
Query: 106 IAVGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVT 165
I+VG+AVPVW NM++QGL+ E VFSFWLNR+ EEGGEIVFGGVD H+KGKHTYVPVT
Sbjct: 202 ISVGNAVPVWYNMIKQGLIKEPVFSFWLNRNTQGEEGGEIVFGGVDLNHYKGKHTYVPVT 261
Query: 166 KKGYWQFELGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVVSAE 225
+KGYWQFE+GD+LIG++ T C GGC+AI DSGTSLLAGPT VVT IN AIG GV S E
Sbjct: 262 QKGYWQFEMGDVLIGHKPTEYCAGGCSAIADSGTSLLAGPTTVVTLINEAIGATGVASQE 321
Query: 226 CKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKEN-VSAG--D 282
CK V++QYG+ I DLL++ P+K+C QIGLC F+G VS GI++VV+ N S+G
Sbjct: 322 CKTVIAQYGETIMDLLIAEAQPKKICSQIGLCTFDGTRGVSMGIQSVVDDNNDKSSGIVR 381
Query: 283 SAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSF 342
A+CSACEM VVW+QNQL++ QT++++L+Y+NELCD +PNP+GESI+DC I +MP VSF
Sbjct: 382 DAMCSACEMTVVWMQNQLRENQTQDRILNYVNELCDRIPNPLGESIVDCGSISSMPVVSF 441
Query: 343 TIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSG 402
TIG K+F+LSP++YILK GEG CISGFMA D+PPPRGPLWILGD+FMG YHTVFD G
Sbjct: 442 TIGGKVFDLSPQEYILKVGEGAQAQCISGFMALDVPPPRGPLWILGDIFMGRYHTVFDYG 501
Query: 403 KLRIGFAEAA 412
LR+GFAEAA
Sbjct: 502 NLRVGFAEAA 511
|
|
| TAIR|locus:2008940 APA1 "aspartic proteinase A1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018037 AT1G62290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2137189 AT4G04460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000217 asp-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| RGD|61940 Napsa "napsin A aspartic peptidase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0279411 ctsD "cathepsin D" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RJN2 CTSE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033933 CG10104 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P43159 CTSE "Cathepsin E" [Oryctolagus cuniculus (taxid:9986)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_XIII0008 | hypothetical protein (507 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 412 | |||
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 1e-122 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 8e-67 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 5e-66 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 6e-62 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 1e-58 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 2e-54 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 3e-54 | |
| cd06098 | 317 | cd06098, phytepsin, Phytepsin, a plant homolog of | 2e-51 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 1e-50 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 2e-50 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 3e-48 | |
| cd05490 | 325 | cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family | 5e-36 | |
| cd05485 | 329 | cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsi | 1e-32 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 2e-29 | |
| pfam00026 | 316 | pfam00026, Asp, Eukaryotic aspartyl protease | 7e-25 | |
| cd05486 | 316 | cd05486, Cathespin_E, Cathepsin E, non-lysosomal a | 1e-24 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 1e-21 | |
| cd05487 | 326 | cd05487, renin_like, Renin stimulates production o | 2e-21 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 4e-20 | |
| cd05488 | 320 | cd05488, Proteinase_A_fungi, Fungal Proteinase A , | 1e-19 | |
| cd05474 | 295 | cd05474, SAP_like, SAPs, pepsin-like proteinases s | 9e-19 | |
| cd06097 | 278 | cd06097, Aspergillopepsin_like, Aspergillopepsin_l | 1e-18 | |
| PTZ00165 | 482 | PTZ00165, PTZ00165, aspartyl protease; Provisional | 5e-17 | |
| cd05473 | 364 | cd05473, beta_secretase_like, Beta-secretase, aspa | 9e-17 | |
| cd05478 | 317 | cd05478, pepsin_A, Pepsin A, aspartic protease pro | 1e-14 | |
| cd05477 | 318 | cd05477, gastricsin, Gastricsins, asparate proteas | 2e-14 | |
| pfam03489 | 35 | pfam03489, SapB_2, Saposin-like type B, region 2 | 3e-11 | |
| pfam05184 | 39 | pfam05184, SapB_1, Saposin-like type B, region 1 | 1e-10 | |
| cd05470 | 109 | cd05470, pepsin_retropepsin_like, Cellular and ret | 5e-10 | |
| cd06096 | 326 | cd06096, Plasmepsin_5, Plasmepsins are a class of | 3e-09 | |
| smart00741 | 76 | smart00741, SapB, Saposin (B) Domains | 2e-08 | |
| PTZ00147 | 453 | PTZ00147, PTZ00147, plasmepsin-1; Provisional | 1e-06 | |
| cd05471 | 283 | cd05471, pepsin_like, Pepsin-like aspartic proteas | 2e-06 | |
| smart00741 | 76 | smart00741, SapB, Saposin (B) Domains | 4e-04 | |
| cd05476 | 265 | cd05476, pepsin_A_like_plant, Chroloplast Nucleoid | 4e-04 | |
| PTZ00013 | 450 | PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisiona | 5e-04 |
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
Score = 357 bits (919), Expect = e-122
Identities = 134/171 (78%), Positives = 153/171 (89%)
Query: 46 GKSCEINYGSGSISGFFSQDNVEVGDVVVKDQVFIEATREGSLTFLLARFDGIIGLGFRE 105
G S I YG+GSISGFFSQD+V VGD+VVK+QVFIEAT+E LTFLLA+FDGI+GLGF+E
Sbjct: 66 GTSASIQYGTGSISGFFSQDSVTVGDLVVKNQVFIEATKEPGLTFLLAKFDGILGLGFQE 125
Query: 106 IAVGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVT 165
I+VG AVPVW NMVEQGLV E VFSFWLNR+PD EEGGE+VFGGVDPKHFKG+HTYVPVT
Sbjct: 126 ISVGKAVPVWYNMVEQGLVKEPVFSFWLNRNPDEEEGGELVFGGVDPKHFKGEHTYVPVT 185
Query: 166 KKGYWQFELGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAI 216
+KGYWQFE+GD+LIG +STG C GGCAAI DSGTSLLAGPT +VT+IN A+
Sbjct: 186 RKGYWQFEMGDVLIGGKSTGFCAGGCAAIADSGTSLLAGPTTIVTQINSAV 236
|
Phytepsin, a plant homolog of mammalian lysosomal pepsins, resides in grains, roots, stems, leaves and flowers. Phytepsin may participate in metabolic turnover and in protein processing events. In addition, it highly expressed in several plant tissues undergoing apoptosis. Phytepsin contains an internal region consisting of about 100 residues not present in animal or microbial pepsins. This region is thus called a plant specific insert. The insert is highly similar to saponins, which are lysosomal sphingolipid-activating proteins in mammalian cells. The saponin-like domain may have a role in the vacuolar targeting of phytepsin. Phytepsin, as its animal counterparts, possesses a topology typical of all aspartic proteases. They are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA). Length = 317 |
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133162 cd06098, phytepsin, Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|133157 cd05490, Cathepsin_D2, Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|133152 cd05485, Cathepsin_D_like, Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215663 pfam00026, Asp, Eukaryotic aspartyl protease | Back alignment and domain information |
|---|
| >gnl|CDD|133153 cd05486, Cathespin_E, Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133154 cd05487, renin_like, Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133155 cd05488, Proteinase_A_fungi, Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133141 cd05474, SAP_like, SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133161 cd06097, Aspergillopepsin_like, Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >gnl|CDD|240300 PTZ00165, PTZ00165, aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133140 cd05473, beta_secretase_like, Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >gnl|CDD|133145 cd05478, pepsin_A, Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >gnl|CDD|133144 cd05477, gastricsin, Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >gnl|CDD|112314 pfam03489, SapB_2, Saposin-like type B, region 2 | Back alignment and domain information |
|---|
| >gnl|CDD|191220 pfam05184, SapB_1, Saposin-like type B, region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133137 cd05470, pepsin_retropepsin_like, Cellular and retroviral pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >gnl|CDD|133160 cd06096, Plasmepsin_5, Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >gnl|CDD|214797 smart00741, SapB, Saposin (B) Domains | Back alignment and domain information |
|---|
| >gnl|CDD|140176 PTZ00147, PTZ00147, plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133138 cd05471, pepsin_like, Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >gnl|CDD|214797 smart00741, SapB, Saposin (B) Domains | Back alignment and domain information |
|---|
| >gnl|CDD|133143 cd05476, pepsin_A_like_plant, Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >gnl|CDD|140051 PTZ00013, PTZ00013, plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 412 | |||
| cd05486 | 316 | Cathespin_E Cathepsin E, non-lysosomal aspartic pr | 100.0 | |
| cd05490 | 325 | Cathepsin_D2 Cathepsin_D2, pepsin family of protei | 100.0 | |
| cd05487 | 326 | renin_like Renin stimulates production of angioten | 100.0 | |
| cd06098 | 317 | phytepsin Phytepsin, a plant homolog of mammalian | 100.0 | |
| cd05477 | 318 | gastricsin Gastricsins, asparate proteases produce | 100.0 | |
| PTZ00165 | 482 | aspartyl protease; Provisional | 100.0 | |
| cd05485 | 329 | Cathepsin_D_like Cathepsin_D_like, pepsin family o | 100.0 | |
| cd05478 | 317 | pepsin_A Pepsin A, aspartic protease produced in g | 100.0 | |
| cd05488 | 320 | Proteinase_A_fungi Fungal Proteinase A , aspartic | 100.0 | |
| PTZ00147 | 453 | plasmepsin-1; Provisional | 100.0 | |
| PTZ00013 | 450 | plasmepsin 4 (PM4); Provisional | 100.0 | |
| PF00026 | 317 | Asp: Eukaryotic aspartyl protease The Prosite entr | 100.0 | |
| cd06097 | 278 | Aspergillopepsin_like Aspergillopepsin_like, aspar | 100.0 | |
| cd05473 | 364 | beta_secretase_like Beta-secretase, aspartic-acid | 100.0 | |
| cd05474 | 295 | SAP_like SAPs, pepsin-like proteinases secreted fr | 100.0 | |
| cd06096 | 326 | Plasmepsin_5 Plasmepsins are a class of aspartic p | 100.0 | |
| cd05472 | 299 | cnd41_like Chloroplast Nucleoids DNA-binding Prote | 100.0 | |
| KOG1339 | 398 | consensus Aspartyl protease [Posttranslational mod | 100.0 | |
| cd05471 | 283 | pepsin_like Pepsin-like aspartic proteases, biloba | 100.0 | |
| cd05476 | 265 | pepsin_A_like_plant Chroloplast Nucleoids DNA-bind | 100.0 | |
| cd05475 | 273 | nucellin_like Nucellins, plant aspartic proteases | 100.0 | |
| PLN03146 | 431 | aspartyl protease family protein; Provisional | 100.0 | |
| cd05489 | 362 | xylanase_inhibitor_I_like TAXI-I inhibits degradat | 100.0 | |
| PF14541 | 161 | TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D | 99.69 | |
| cd05470 | 109 | pepsin_retropepsin_like Cellular and retroviral pe | 99.66 | |
| PF14543 | 164 | TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A | 99.65 | |
| PF05184 | 39 | SapB_1: Saposin-like type B, region 1; InterPro: I | 98.16 | |
| PF03489 | 35 | SapB_2: Saposin-like type B, region 2; InterPro: I | 98.01 | |
| KOG1340 | 218 | consensus Prosaposin [Lipid transport and metaboli | 96.97 | |
| smart00741 | 76 | SapB Saposin (B) Domains. Present in multiple copi | 95.65 | |
| smart00741 | 76 | SapB Saposin (B) Domains. Present in multiple copi | 94.72 | |
| cd05483 | 96 | retropepsin_like_bacteria Bacterial aspartate prot | 94.01 | |
| cd05479 | 124 | RP_DDI RP_DDI; retropepsin-like domain of DNA dama | 91.77 | |
| TIGR02281 | 121 | clan_AA_DTGA clan AA aspartic protease, TIGR02281 | 91.12 | |
| KOG1340 | 218 | consensus Prosaposin [Lipid transport and metaboli | 90.5 | |
| PF08284 | 135 | RVP_2: Retroviral aspartyl protease; InterPro: IPR | 85.6 | |
| PF13650 | 90 | Asp_protease_2: Aspartyl protease | 81.22 |
| >cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.9e-56 Score=438.62 Aligned_cols=306 Identities=39% Similarity=0.742 Sum_probs=271.4
Q ss_pred cccccceeeecCccCccceEEecC----CCCCCCCCCCCCCCCceEECCcEEEEEEcCceEEEEEEEEEEEECCeEEeee
Q 015145 2 LNTLERLVLALPHKISVSYLIPAV----PISGFHLQSAISLFPAISIRGKSCEINYGSGSISGFFSQDNVEVGDVVVKDQ 77 (412)
Q Consensus 2 ~~t~~~~~~~~p~t~s~~~wvp~~----~~c~~~~~y~p~~Sst~~~~~~~~~i~Y~~gs~~G~~~~D~v~lg~~~~~~~ 77 (412)
+|||+|.+.+..||||+++||++. ..|..|+.|+|++|+|++..++++++.|++|++.|.+++|+|++++..+.++
T Consensus 7 iGtP~Q~~~v~~DTGSs~~Wv~s~~C~~~~C~~~~~y~~~~SsT~~~~~~~~~i~Yg~g~~~G~~~~D~v~ig~~~~~~~ 86 (316)
T cd05486 7 IGTPPQNFTVIFDTGSSNLWVPSIYCTSQACTKHNRFQPSESSTYVSNGEAFSIQYGTGSLTGIIGIDQVTVEGITVQNQ 86 (316)
T ss_pred ECCCCcEEEEEEcCCCccEEEecCCCCCcccCccceECCCCCcccccCCcEEEEEeCCcEEEEEeeecEEEECCEEEcCE
Confidence 689999999999999999999986 2588899999999999999999999999999999999999999999999999
Q ss_pred EEEEEEeecCcccccCCccEEEeccCCccccCCCCchHHHHHHcCCCCCCeEEEEecCCCCCCCCcEEEeCCCCCCCeec
Q 015145 78 VFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKG 157 (412)
Q Consensus 78 ~fg~~~~~~~~~~~~~~~dGilGLg~~~~s~~~~~~~~~~L~~qg~i~~~~Fsl~l~~~~~~~~~G~l~fGg~D~~~~~g 157 (412)
.||++..+.+..|....++||||||++..+..+..|++++|++||+|++++||+||.+.++....|+|+|||+|++++.|
T Consensus 87 ~fg~~~~~~~~~~~~~~~dGilGLg~~~~s~~~~~p~~~~l~~qg~i~~~~FS~~L~~~~~~~~~g~l~fGg~d~~~~~g 166 (316)
T cd05486 87 QFAESVSEPGSTFQDSEFDGILGLAYPSLAVDGVTPVFDNMMAQNLVELPMFSVYMSRNPNSADGGELVFGGFDTSRFSG 166 (316)
T ss_pred EEEEeeccCcccccccccceEeccCchhhccCCCCCHHHHHHhcCCCCCCEEEEEEccCCCCCCCcEEEEcccCHHHccc
Confidence 99998877655566667899999999988766778899999999999999999999976544458999999999999999
Q ss_pred CceEeeccccceeEEEEceEEECCeeeceecCCceEEEcCCCCCcccCHHHHHHHHHHhCCCceeecchhhhhhhchhhH
Q 015145 158 KHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDLI 237 (412)
Q Consensus 158 ~l~~~p~~~~~~w~v~~~~i~v~~~~~~~~~~~~~~ivDSGts~i~lP~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~ 237 (412)
++.|+|+.+..+|.|.+++|+|+++.+. +.....++|||||+++++|.++++++.+.+++.
T Consensus 167 ~l~~~pi~~~~~w~v~l~~i~v~g~~~~-~~~~~~aiiDTGTs~~~lP~~~~~~l~~~~~~~------------------ 227 (316)
T cd05486 167 QLNWVPVTVQGYWQIQLDNIQVGGTVIF-CSDGCQAIVDTGTSLITGPSGDIKQLQNYIGAT------------------ 227 (316)
T ss_pred ceEEEECCCceEEEEEeeEEEEecceEe-cCCCCEEEECCCcchhhcCHHHHHHHHHHhCCc------------------
Confidence 9999999999999999999999998764 345678999999999999999999998888543
Q ss_pred HHHHhhCCCccchhhcccccccCCcceeccceeeeeeccccccCCcccchhhhhHHHHHHhhhhhhhhHHHHHHHhhhhc
Q 015145 238 WDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGDSAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELC 317 (412)
Q Consensus 238 ~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~c 317 (412)
T Consensus 228 -------------------------------------------------------------------------------- 227 (316)
T cd05486 228 -------------------------------------------------------------------------------- 227 (316)
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred cCCCCCCCceeeeCCCCCCCCcEEEEECCEEEEeCcccceEEeccccccceeeeeeeccCCCCCCCcEEEccccccceEE
Q 015145 318 DSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHT 397 (412)
Q Consensus 318 ~~~~~~~~~~~ipC~~~~~lp~l~f~~gg~~~~i~p~~yl~~~~~~~~~~C~~~i~~~~~~~~~~~~~iLG~~fl~~~yv 397 (412)
...+.|.+||+....+|+|+|+|+|+.++|+|++|++.....+..+|+++|+..+..+..++.||||++|||++|+
T Consensus 228 ----~~~~~~~~~C~~~~~~p~i~f~f~g~~~~l~~~~y~~~~~~~~~~~C~~~~~~~~~~~~~~~~~ILGd~flr~~y~ 303 (316)
T cd05486 228 ----ATDGEYGVDCSTLSLMPSVTFTINGIPYSLSPQAYTLEDQSDGGGYCSSGFQGLDIPPPAGPLWILGDVFIRQYYS 303 (316)
T ss_pred ----ccCCcEEEeccccccCCCEEEEECCEEEEeCHHHeEEecccCCCCEEeeEEEECCCCCCCCCeEEEchHHhcceEE
Confidence 1135688999988889999999999999999999998754334568999998776544455689999999999999
Q ss_pred EEeCCCCeEEEEe
Q 015145 398 VFDSGKLRIGFAE 410 (412)
Q Consensus 398 vfD~e~~rIGfa~ 410 (412)
|||.+++|||||+
T Consensus 304 vfD~~~~~IGfA~ 316 (316)
T cd05486 304 VFDRGNNRVGFAP 316 (316)
T ss_pred EEeCCCCEeeccC
Confidence 9999999999996
|
Cathepsin E is an intracellular, non-lysosomal aspartic protease expressed in a variety of cells and tissues. The protease has proposed physiological roles in antigen presentation by the MHC class II system, in the biogenesis of the vasoconstrictor peptide endothelin, and in neurodegeneration associated with brain ischemia and aging. Cathepsin E is the only A1 aspartic protease that exists as a homodimer with a disulfide bridge linking the two monomers. Like many other aspartic proteases, it is synthesized as a zymogen which is catalytically inactive towards its natural substrates at neutral pH and which auto-activates in an acidic environment. The overall structure follows the general fold of aspartic proteases of the A1 family, it is composed of two structurally similar beta barrel lobes, each lobe contributing an aspartic acid residue to form a catalytic dyad that acts to cleave the substrate peptide bond. The catalyt |
| >cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases | Back alignment and domain information |
|---|
| >cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure | Back alignment and domain information |
|---|
| >cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins | Back alignment and domain information |
|---|
| >cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa | Back alignment and domain information |
|---|
| >PTZ00165 aspartyl protease; Provisional | Back alignment and domain information |
|---|
| >cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases | Back alignment and domain information |
|---|
| >cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals | Back alignment and domain information |
|---|
| >cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily | Back alignment and domain information |
|---|
| >PTZ00147 plasmepsin-1; Provisional | Back alignment and domain information |
|---|
| >PTZ00013 plasmepsin 4 (PM4); Provisional | Back alignment and domain information |
|---|
| >PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 | Back alignment and domain information |
|---|
| >cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin | Back alignment and domain information |
|---|
| >cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease | Back alignment and domain information |
|---|
| >cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins | Back alignment and domain information |
|---|
| >cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite | Back alignment and domain information |
|---|
| >cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase | Back alignment and domain information |
|---|
| >KOG1339 consensus Aspartyl protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH | Back alignment and domain information |
|---|
| >cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants | Back alignment and domain information |
|---|
| >cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation | Back alignment and domain information |
|---|
| >PLN03146 aspartyl protease family protein; Provisional | Back alignment and domain information |
|---|
| >cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall | Back alignment and domain information |
|---|
| >PF14541 TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D 3HD8_A 1T6G_A 1T6E_X 2B42_A 3VLB_A 3VLA_A | Back alignment and domain information |
|---|
| >cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases | Back alignment and domain information |
|---|
| >PF14543 TAXi_N: Xylanase inhibitor N-terminal; PDB: 3HD8_A 3VLB_A 3VLA_A 3AUP_D 1T6G_A 1T6E_X 2B42_A | Back alignment and domain information |
|---|
| >PF05184 SapB_1: Saposin-like type B, region 1; InterPro: IPR007856 Synonym(s):cerebroside sulphate activator, CSAct Saposin B is a small non-enzymatic glycoprotein required for the breakdown of cerebroside sulphates (sulphatides) in lysosomes | Back alignment and domain information |
|---|
| >PF03489 SapB_2: Saposin-like type B, region 2; InterPro: IPR008138 Saposins are small lysosomal proteins that serve as activators of various lysosomal lipid-degrading enzymes [] | Back alignment and domain information |
|---|
| >KOG1340 consensus Prosaposin [Lipid transport and metabolism; Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00741 SapB Saposin (B) Domains | Back alignment and domain information |
|---|
| >smart00741 SapB Saposin (B) Domains | Back alignment and domain information |
|---|
| >cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family | Back alignment and domain information |
|---|
| >cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein | Back alignment and domain information |
|---|
| >TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family | Back alignment and domain information |
|---|
| >KOG1340 consensus Prosaposin [Lipid transport and metabolism; Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) | Back alignment and domain information |
|---|
| >PF13650 Asp_protease_2: Aspartyl protease | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 412 | ||||
| 1qdm_A | 478 | Crystal Structure Of Prophytepsin, A Zymogen Of A B | 1e-134 | ||
| 1b5f_A | 239 | Native Cardosin A From Cynara Cardunculus L. Length | 3e-53 | ||
| 1lya_B | 241 | Crystal Structures Of Native And Inhibited Forms Of | 3e-36 | ||
| 1lya_B | 241 | Crystal Structures Of Native And Inhibited Forms Of | 8e-25 | ||
| 1tzs_A | 351 | Crystal Structure Of An Activation Intermediate Of | 1e-34 | ||
| 1tzs_A | 351 | Crystal Structure Of An Activation Intermediate Of | 4e-16 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 1e-33 | ||
| 2x0b_A | 383 | Crystal Structure Of Human Angiotensinogen Complexe | 7e-14 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 1e-33 | ||
| 2bks_A | 340 | Crystal Structure Of Renin-Pf00074777 Complex Lengt | 7e-14 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 1e-33 | ||
| 3d91_A | 341 | Human Renin In Complex With Remikiren Length = 341 | 7e-14 | ||
| 3rfi_A | 108 | Crystal Structure Of The Saposin-Like Domain Of Pla | 1e-33 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 1e-33 | ||
| 2g24_A | 333 | Ketopiperazine-Based Renin Inhibitors: Optimization | 7e-14 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 1e-33 | ||
| 1hrn_A | 337 | High Resolution Crystal Structures Of Recombinant H | 7e-14 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 2e-33 | ||
| 2i4q_A | 336 | Human ReninPF02342674 COMPLEX Length = 336 | 7e-14 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 7e-33 | ||
| 3vcm_A | 335 | Crystal Structure Of Human Prorenin Length = 335 | 8e-14 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 2e-30 | ||
| 1smr_A | 335 | The 3-D Structure Of Mouse Submaxillary Renin Compl | 3e-16 | ||
| 1g0v_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 3e-28 | ||
| 1g0v_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 1e-09 | ||
| 1dp5_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 3e-28 | ||
| 1dp5_A | 329 | The Structure Of Proteinase A Complexed With A Ia3 | 1e-09 | ||
| 2jxr_A | 329 | Structure Of Yeast Proteinase A Length = 329 | 3e-28 | ||
| 2jxr_A | 329 | Structure Of Yeast Proteinase A Length = 329 | 1e-09 | ||
| 1htr_B | 329 | Crystal And Molecular Structures Of Human Progastri | 4e-28 | ||
| 1htr_B | 329 | Crystal And Molecular Structures Of Human Progastri | 5e-11 | ||
| 3psg_A | 370 | The High Resolution Crystal Structure Of Porcine Pe | 1e-27 | ||
| 3psg_A | 370 | The High Resolution Crystal Structure Of Porcine Pe | 4e-15 | ||
| 5pep_A | 326 | X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dim | 1e-27 | ||
| 5pep_A | 326 | X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dim | 3e-15 | ||
| 1psa_A | 326 | Structure Of A Pepsin(Slash)renin Inhibitor Complex | 1e-27 | ||
| 1psa_A | 326 | Structure Of A Pepsin(Slash)renin Inhibitor Complex | 3e-15 | ||
| 3pep_A | 326 | Revised 2.3 Angstroms Structure Of Porcine Pepsin. | 2e-27 | ||
| 3pep_A | 326 | Revised 2.3 Angstroms Structure Of Porcine Pepsin. | 4e-15 | ||
| 2psg_A | 370 | Refined Structure Of Porcine Pepsinogen At 1.8 Angs | 2e-27 | ||
| 2psg_A | 370 | Refined Structure Of Porcine Pepsinogen At 1.8 Angs | 4e-15 | ||
| 1f34_A | 326 | Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bou | 2e-27 | ||
| 1f34_A | 326 | Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bou | 3e-15 | ||
| 4pep_A | 326 | The Molecular And Crystal Structures Of Monoclinic | 2e-27 | ||
| 4pep_A | 326 | The Molecular And Crystal Structures Of Monoclinic | 4e-15 | ||
| 1pso_E | 326 | The Crystal Structure Of Human Pepsin And Its Compl | 1e-26 | ||
| 1pso_E | 326 | The Crystal Structure Of Human Pepsin And Its Compl | 2e-13 | ||
| 1flh_A | 326 | Crystal Structure Of Human Uropepsin At 2.45 A Reso | 1e-26 | ||
| 1flh_A | 326 | Crystal Structure Of Human Uropepsin At 2.45 A Reso | 5e-13 | ||
| 4aa9_A | 320 | Camel Chymosin At 1.6a Resolution Length = 320 | 6e-26 | ||
| 4aa9_A | 320 | Camel Chymosin At 1.6a Resolution Length = 320 | 2e-09 | ||
| 1czi_E | 323 | Chymosin Complex With The Inhibitor Cp-113972 Lengt | 2e-25 | ||
| 1czi_E | 323 | Chymosin Complex With The Inhibitor Cp-113972 Lengt | 1e-09 | ||
| 1b5f_B | 87 | Native Cardosin A From Cynara Cardunculus L. Length | 2e-25 | ||
| 3cms_A | 323 | Engineering Enzyme Sub-Site Specificity: Preparatio | 3e-25 | ||
| 3cms_A | 323 | Engineering Enzyme Sub-Site Specificity: Preparatio | 1e-09 | ||
| 1am5_A | 324 | The Crystal Structure And Proposed Amino Acid Seque | 5e-25 | ||
| 1am5_A | 324 | The Crystal Structure And Proposed Amino Acid Seque | 8e-11 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 3e-18 | ||
| 3qrv_A | 336 | Crystal Structure Of Plasmepsin I (Pmi) From Plasmo | 5e-05 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 4e-16 | ||
| 2anl_A | 327 | X-Ray Crystal Structure Of The Aspartic Protease Pl | 5e-04 | ||
| 3oad_A | 166 | Design And Optimization Of New Piperidines As Renin | 5e-15 | ||
| 1miq_A | 375 | Crystal Structure Of Proplasmepsin From The Human M | 1e-14 | ||
| 1miq_A | 375 | Crystal Structure Of Proplasmepsin From The Human M | 1e-04 | ||
| 3f9q_A | 329 | Re-Refinement Of Uncomplexed Plasmepsin Ii From Pla | 1e-14 | ||
| 3f9q_A | 329 | Re-Refinement Of Uncomplexed Plasmepsin Ii From Pla | 4e-04 | ||
| 1m43_A | 331 | Crystal Structure Of Pmii In Complex With Pepstatin | 1e-14 | ||
| 1m43_A | 331 | Crystal Structure Of Pmii In Complex With Pepstatin | 4e-04 | ||
| 2bju_A | 453 | Plasmepsin Ii Complexed With A Highly Active Achira | 3e-14 | ||
| 2bju_A | 453 | Plasmepsin Ii Complexed With A Highly Active Achira | 4e-04 | ||
| 1pfz_A | 380 | Proplasmepsin Ii From Plasmodium Falciparum Length | 3e-14 | ||
| 1pfz_A | 380 | Proplasmepsin Ii From Plasmodium Falciparum Length | 4e-04 | ||
| 1sme_A | 329 | Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From P | 3e-14 | ||
| 1sme_A | 329 | Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From P | 4e-04 | ||
| 1ls5_A | 328 | Crystal Structure Of Plasmepsin Iv From P. Falcipar | 4e-14 | ||
| 1lf3_A | 331 | Crystal Structure Of Plasmepsin Ii From P Falciparu | 4e-14 | ||
| 1lf3_A | 331 | Crystal Structure Of Plasmepsin Ii From P Falciparu | 4e-04 | ||
| 1qs8_B | 329 | Crystal Structure Of The P. Vivax Aspartic Proteina | 5e-14 | ||
| 1qs8_B | 329 | Crystal Structure Of The P. Vivax Aspartic Proteina | 1e-04 | ||
| 3oad_B | 176 | Design And Optimization Of New Piperidines As Renin | 6e-14 | ||
| 1yg9_A | 330 | The Structure Of Mutant (N93q) Of Bla G 2 Length = | 7e-14 | ||
| 1yg9_A | 330 | The Structure Of Mutant (N93q) Of Bla G 2 Length = | 3e-07 | ||
| 3liz_A | 334 | Crystal Structure Of Bla G 2 Complexed With Fab 4c3 | 7e-14 | ||
| 3liz_A | 334 | Crystal Structure Of Bla G 2 Complexed With Fab 4c3 | 4e-07 | ||
| 1uh7_A | 325 | Crystal Structure Of Rhizopuspepsin At Ph 4.6 Lengt | 2e-09 | ||
| 3apr_E | 325 | Binding Of A Reduced Peptide Inhibitor To The Aspar | 2e-09 | ||
| 2ewy_A | 383 | Crystal Structure Of Human Bace2 In Complex With A | 6e-09 | ||
| 3fns_A | 332 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 8e-09 | ||
| 3fns_A | 332 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 2e-04 | ||
| 3qvc_A | 451 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 1e-08 | ||
| 3qvc_A | 451 | Crystal Structure Of Histo-Aspartic Protease (Hap) | 3e-04 | ||
| 1eag_A | 342 | Secreted Aspartic Proteinase (Sap2) From Candida Al | 2e-08 | ||
| 1zap_A | 342 | Secreted Aspartic Protease From C. Albicans Length | 4e-08 | ||
| 2h6s_A | 340 | Secreted Aspartic Proteinase (sap) 3 From Candida A | 2e-07 | ||
| 1j71_A | 334 | Structure Of The Extracellular Aspartic Proteinase | 2e-07 | ||
| 2qzw_A | 341 | Secreted Aspartic Proteinase (Sap) 1 From Candida A | 1e-06 | ||
| 1wkr_A | 340 | Crystal Structure Of Aspartic Proteinase From Irpex | 3e-06 | ||
| 2qzx_A | 342 | Secreted Aspartic Proteinase (Sap) 5 From Candida A | 3e-06 | ||
| 3fv3_A | 339 | Secreted Aspartic Protease 1 From Candida Parapsilo | 6e-06 | ||
| 3bra_A | 409 | Bace-1 Complexed With Compound 1 Length = 409 | 2e-05 | ||
| 3cib_A | 390 | Structure Of Bace Bound To Sch727596 Length = 390 | 3e-05 | ||
| 2fdp_A | 388 | Crystal Structure Of Beta-Secretase Complexed With | 3e-05 | ||
| 1fkn_A | 391 | Structure Of Beta-Secretase Complexed With Inhibito | 3e-05 | ||
| 4ewo_A | 386 | Design And Synthesis Of Potent Hydroxyethylamine (H | 3e-05 | ||
| 3vv6_A | 416 | Crystal Structure Of Beta Secetase In Complex With | 3e-05 | ||
| 4dpf_A | 391 | Bace-1 In Complex With A Hea-Macrocyclic Type Inhib | 3e-05 | ||
| 1w50_A | 411 | Apo Structure Of Bace (beta Secretase) Length = 411 | 3e-05 | ||
| 2zjn_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 3e-05 | ||
| 2wjo_A | 412 | Human Bace (Beta Secretase) In Complex With Cyclohe | 3e-05 | ||
| 2zjh_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 3e-05 | ||
| 3ckp_A | 412 | Crystal Structure Of Bace-1 In Complex With Inhibit | 3e-05 | ||
| 2hm1_A | 406 | Crystal Structure Of Human Beta-Secretase (Bace) In | 3e-05 | ||
| 3exo_A | 413 | Crystal Structure Of Bace1 Bound To Inhibitor Lengt | 3e-05 | ||
| 3kmx_A | 395 | Structure Of Bace Bound To Sch346572 Length = 395 | 3e-05 | ||
| 2zhr_A | 411 | Crystal Structure Of Bace1 In Complex With Om99-2 A | 3e-05 | ||
| 3udh_A | 404 | Crystal Structure Of Bace With Compound 1 Length = | 3e-05 | ||
| 3r1g_B | 402 | Structure Basis Of Allosteric Inhibition Of Bace1 B | 3e-05 | ||
| 1tqf_A | 405 | Crystal Structure Of Human Beta Secretase Complexed | 3e-05 | ||
| 3u6a_A | 390 | Rational Design And Synthesis Of Aminopiperazinones | 3e-05 | ||
| 1sgz_A | 389 | Crystal Structure Of Unbound Beta-Secretase Catalyt | 3e-05 | ||
| 3l58_A | 414 | Structure Of Bace Bound To Sch589432 Length = 414 | 3e-05 | ||
| 2zjk_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 3e-05 | ||
| 2zji_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 3e-05 | ||
| 3dm6_A | 406 | Beta-Secretase 1 Complexed With Statine-Based Inhib | 3e-05 | ||
| 3ixk_A | 405 | Potent Beta-Secretase 1 Inhibitor Length = 405 | 3e-05 | ||
| 2qk5_A | 395 | Structure Of Bace1 Bound To Sch626485 Length = 395 | 3e-05 | ||
| 4b1d_A | 388 | New Aminoimidazoles As Bace-1 Inhibitors: From Rati | 3e-05 | ||
| 3tpj_A | 433 | Apo Structure Of Bace1 Length = 433 | 3e-05 | ||
| 3hvg_A | 411 | Structure Of Bace (Beta Secretase) In Complex With | 3e-05 | ||
| 2qzl_A | 411 | Crystal Structure Of Human Beta Secretase Complexed | 3e-05 | ||
| 1ym2_A | 402 | Crystal Structure Of Human Beta Secretase Complexed | 3e-05 | ||
| 1ym4_A | 408 | Crystal Structure Of Human Beta Secretase Complexed | 3e-05 | ||
| 3qi1_A | 408 | Design And Synthesis Of Hydroxyethylamine (Hea) Bac | 3e-05 | ||
| 2qu2_A | 415 | Bace1 With Compound 1 Length = 415 | 3e-05 | ||
| 2of0_A | 402 | X-Ray Crystal Structure Of Beta Secretase Complexed | 3e-05 | ||
| 3tpr_A | 433 | Crystal Structure Of Bace1 Complexed With An Inhibi | 3e-05 | ||
| 2va5_A | 455 | X-Ray Crystal Structure Of Beta Secretase Complexed | 4e-05 | ||
| 3lpi_A | 455 | Structure Of Bace Bound To Sch745132 Length = 455 | 4e-05 | ||
| 2hiz_A | 455 | Crystal Structure Of Human Beta-Secretase (Bace) In | 4e-05 | ||
| 2q11_A | 388 | Structure Of Bace Complexed To Compound 1 Length = | 4e-05 | ||
| 2q15_A | 385 | Structure Of Bace Complexed To Compound 3a Length = | 4e-05 | ||
| 2vie_A | 392 | Human Bace-1 In Complex With N-((1s,2r)-1-Benzyl-2- | 4e-05 | ||
| 2zjj_A | 405 | Crystal Structure Of The Human Bace1 Catalytic Doma | 2e-04 | ||
| 2rmp_A | 361 | Rmp-Pepstatin A Complex Length = 361 | 6e-04 |
| >pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley Vacuolar Aspartic Proteinase. Length = 478 | Back alignment and structure |
|
| >pdb|1B5F|A Chain A, Native Cardosin A From Cynara Cardunculus L. Length = 239 | Back alignment and structure |
| >pdb|1LYA|B Chain B, Crystal Structures Of Native And Inhibited Forms Of Human Cathepsin D: Implications For Lysosomal Targeting And Drug Design Length = 241 | Back alignment and structure |
| >pdb|1LYA|B Chain B, Crystal Structures Of Native And Inhibited Forms Of Human Cathepsin D: Implications For Lysosomal Targeting And Drug Design Length = 241 | Back alignment and structure |
| >pdb|1TZS|A Chain A, Crystal Structure Of An Activation Intermediate Of Cathepsin E Length = 351 | Back alignment and structure |
| >pdb|1TZS|A Chain A, Crystal Structure Of An Activation Intermediate Of Cathepsin E Length = 351 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|2X0B|A Chain A, Crystal Structure Of Human Angiotensinogen Complexed With Renin Length = 383 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|2BKS|A Chain A, Crystal Structure Of Renin-Pf00074777 Complex Length = 340 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|3D91|A Chain A, Human Renin In Complex With Remikiren Length = 341 | Back alignment and structure |
| >pdb|3RFI|A Chain A, Crystal Structure Of The Saposin-Like Domain Of Plant Aspartic Protease From Solanum Tuberosum Length = 108 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|2G24|A Chain A, Ketopiperazine-Based Renin Inhibitors: Optimization Of The "c" Ring Length = 333 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|1HRN|A Chain A, High Resolution Crystal Structures Of Recombinant Human Renin In Complex With Polyhydroxymonoamide Inhibitors Length = 337 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|2I4Q|A Chain A, Human ReninPF02342674 COMPLEX Length = 336 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|3VCM|A Chain A, Crystal Structure Of Human Prorenin Length = 335 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|1SMR|A Chain A, The 3-D Structure Of Mouse Submaxillary Renin Complexed With A Decapeptide Inhibitor Ch-66 Based On The 4-16 Fragment Of Rat Angiotensinogen Length = 335 | Back alignment and structure |
| >pdb|1G0V|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant, Mvv Length = 329 | Back alignment and structure |
| >pdb|1G0V|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant, Mvv Length = 329 | Back alignment and structure |
| >pdb|1DP5|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant Inhibitor Length = 329 | Back alignment and structure |
| >pdb|1DP5|A Chain A, The Structure Of Proteinase A Complexed With A Ia3 Mutant Inhibitor Length = 329 | Back alignment and structure |
| >pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A Length = 329 | Back alignment and structure |
| >pdb|2JXR|A Chain A, Structure Of Yeast Proteinase A Length = 329 | Back alignment and structure |
| >pdb|1HTR|B Chain B, Crystal And Molecular Structures Of Human Progastricsin At 1.62 Angstroms Resolution Length = 329 | Back alignment and structure |
| >pdb|1HTR|B Chain B, Crystal And Molecular Structures Of Human Progastricsin At 1.62 Angstroms Resolution Length = 329 | Back alignment and structure |
| >pdb|3PSG|A Chain A, The High Resolution Crystal Structure Of Porcine Pepsinogen Length = 370 | Back alignment and structure |
| >pdb|3PSG|A Chain A, The High Resolution Crystal Structure Of Porcine Pepsinogen Length = 370 | Back alignment and structure |
| >pdb|5PEP|A Chain A, X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dimensional Structure Of The Hexagonal Crystal Form Of Porcine Pepsin At 2.3 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|5PEP|A Chain A, X-Ray Analyses Of Aspartic Proteases. Ii. Three-Dimensional Structure Of The Hexagonal Crystal Form Of Porcine Pepsin At 2.3 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|1PSA|A Chain A, Structure Of A Pepsin(Slash)renin Inhibitor Complex Reveals A Novel Crystal Packing Induced By Minor Chemical Alterations In The Inhibitor Length = 326 | Back alignment and structure |
| >pdb|1PSA|A Chain A, Structure Of A Pepsin(Slash)renin Inhibitor Complex Reveals A Novel Crystal Packing Induced By Minor Chemical Alterations In The Inhibitor Length = 326 | Back alignment and structure |
| >pdb|3PEP|A Chain A, Revised 2.3 Angstroms Structure Of Porcine Pepsin. Evidence For A Flexible Subdomain Length = 326 | Back alignment and structure |
| >pdb|3PEP|A Chain A, Revised 2.3 Angstroms Structure Of Porcine Pepsin. Evidence For A Flexible Subdomain Length = 326 | Back alignment and structure |
| >pdb|2PSG|A Chain A, Refined Structure Of Porcine Pepsinogen At 1.8 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|2PSG|A Chain A, Refined Structure Of Porcine Pepsinogen At 1.8 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bound To Porcine Pepsin Length = 326 | Back alignment and structure |
| >pdb|1F34|A Chain A, Crystal Structure Of Ascaris Pepsin Inhibitor-3 Bound To Porcine Pepsin Length = 326 | Back alignment and structure |
| >pdb|4PEP|A Chain A, The Molecular And Crystal Structures Of Monoclinic Porcine Pepsin Refined At 1.8 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|4PEP|A Chain A, The Molecular And Crystal Structures Of Monoclinic Porcine Pepsin Refined At 1.8 Angstroms Resolution Length = 326 | Back alignment and structure |
| >pdb|1PSO|E Chain E, The Crystal Structure Of Human Pepsin And Its Complex With Pepstatin Length = 326 | Back alignment and structure |
| >pdb|1PSO|E Chain E, The Crystal Structure Of Human Pepsin And Its Complex With Pepstatin Length = 326 | Back alignment and structure |
| >pdb|1FLH|A Chain A, Crystal Structure Of Human Uropepsin At 2.45 A Resolution Length = 326 | Back alignment and structure |
| >pdb|1FLH|A Chain A, Crystal Structure Of Human Uropepsin At 2.45 A Resolution Length = 326 | Back alignment and structure |
| >pdb|4AA9|A Chain A, Camel Chymosin At 1.6a Resolution Length = 320 | Back alignment and structure |
| >pdb|4AA9|A Chain A, Camel Chymosin At 1.6a Resolution Length = 320 | Back alignment and structure |
| >pdb|1CZI|E Chain E, Chymosin Complex With The Inhibitor Cp-113972 Length = 323 | Back alignment and structure |
| >pdb|1CZI|E Chain E, Chymosin Complex With The Inhibitor Cp-113972 Length = 323 | Back alignment and structure |
| >pdb|1B5F|B Chain B, Native Cardosin A From Cynara Cardunculus L. Length = 87 | Back alignment and structure |
| >pdb|3CMS|A Chain A, Engineering Enzyme Sub-Site Specificity: Preparation, Kinetic Characterization And X-Ray Analysis At 2.0-Angstroms Resolution Of Val111phe Site-Mutated Calf Chymosin Length = 323 | Back alignment and structure |
| >pdb|3CMS|A Chain A, Engineering Enzyme Sub-Site Specificity: Preparation, Kinetic Characterization And X-Ray Analysis At 2.0-Angstroms Resolution Of Val111phe Site-Mutated Calf Chymosin Length = 323 | Back alignment and structure |
| >pdb|1AM5|A Chain A, The Crystal Structure And Proposed Amino Acid Sequence Of A Pepsin From Atlantic Cod (Gadus Morhua) Length = 324 | Back alignment and structure |
| >pdb|1AM5|A Chain A, The Crystal Structure And Proposed Amino Acid Sequence Of A Pepsin From Atlantic Cod (Gadus Morhua) Length = 324 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|3QRV|A Chain A, Crystal Structure Of Plasmepsin I (Pmi) From Plasmodium Falciparum Length = 336 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|2ANL|A Chain A, X-Ray Crystal Structure Of The Aspartic Protease Plasmepsin 4 From The Malarial Parasite Plasmodium Malariae Bound To An Allophenylnorstatine Based Inhibitor Length = 327 | Back alignment and structure |
| >pdb|3OAD|A Chain A, Design And Optimization Of New Piperidines As Renin Inhibitors Length = 166 | Back alignment and structure |
| >pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmepsin From The Human Malarial Pathogen Plasmodium Vivax Length = 375 | Back alignment and structure |
| >pdb|1MIQ|A Chain A, Crystal Structure Of Proplasmepsin From The Human Malarial Pathogen Plasmodium Vivax Length = 375 | Back alignment and structure |
| >pdb|3F9Q|A Chain A, Re-Refinement Of Uncomplexed Plasmepsin Ii From Plasmodium Falciparum Length = 329 | Back alignment and structure |
| >pdb|3F9Q|A Chain A, Re-Refinement Of Uncomplexed Plasmepsin Ii From Plasmodium Falciparum Length = 329 | Back alignment and structure |
| >pdb|1M43|A Chain A, Crystal Structure Of Pmii In Complex With Pepstatin A To 2.4 A Length = 331 | Back alignment and structure |
| >pdb|1M43|A Chain A, Crystal Structure Of Pmii In Complex With Pepstatin A To 2.4 A Length = 331 | Back alignment and structure |
| >pdb|2BJU|A Chain A, Plasmepsin Ii Complexed With A Highly Active Achiral Inhibitor Length = 453 | Back alignment and structure |
| >pdb|2BJU|A Chain A, Plasmepsin Ii Complexed With A Highly Active Achiral Inhibitor Length = 453 | Back alignment and structure |
| >pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium Falciparum Length = 380 | Back alignment and structure |
| >pdb|1PFZ|A Chain A, Proplasmepsin Ii From Plasmodium Falciparum Length = 380 | Back alignment and structure |
| >pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From Plasmodium Falciparum, In Complex With Pepstatin A Length = 329 | Back alignment and structure |
| >pdb|1SME|A Chain A, Plasmepsin Ii, A Hemoglobin-Degrading Enzyme From Plasmodium Falciparum, In Complex With Pepstatin A Length = 329 | Back alignment and structure |
| >pdb|1LS5|A Chain A, Crystal Structure Of Plasmepsin Iv From P. Falciparum In Complex With Pepstatin A Length = 328 | Back alignment and structure |
| >pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin Ii From P Falciparum In Complex With Inhibitor Eh58 Length = 331 | Back alignment and structure |
| >pdb|1LF3|A Chain A, Crystal Structure Of Plasmepsin Ii From P Falciparum In Complex With Inhibitor Eh58 Length = 331 | Back alignment and structure |
| >pdb|3OAD|B Chain B, Design And Optimization Of New Piperidines As Renin Inhibitors Length = 176 | Back alignment and structure |
| >pdb|1YG9|A Chain A, The Structure Of Mutant (N93q) Of Bla G 2 Length = 330 | Back alignment and structure |
| >pdb|1YG9|A Chain A, The Structure Of Mutant (N93q) Of Bla G 2 Length = 330 | Back alignment and structure |
| >pdb|3LIZ|A Chain A, Crystal Structure Of Bla G 2 Complexed With Fab 4c3 Length = 334 | Back alignment and structure |
| >pdb|3LIZ|A Chain A, Crystal Structure Of Bla G 2 Complexed With Fab 4c3 Length = 334 | Back alignment and structure |
| >pdb|1UH7|A Chain A, Crystal Structure Of Rhizopuspepsin At Ph 4.6 Length = 325 | Back alignment and structure |
| >pdb|3APR|E Chain E, Binding Of A Reduced Peptide Inhibitor To The Aspartic Proteinase From Rhizopus Chinensis. Implications For A Mechanism Of Action Length = 325 | Back alignment and structure |
| >pdb|2EWY|A Chain A, Crystal Structure Of Human Bace2 In Complex With A Hydroxyethylenamine Transition-State Inhibitor Length = 383 | Back alignment and structure |
| >pdb|3FNS|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) From Plasmodium Falciparum Length = 332 | Back alignment and structure |
| >pdb|3FNS|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) From Plasmodium Falciparum Length = 332 | Back alignment and structure |
| >pdb|3QVC|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) Zymogen From Plasmodium Falciparum Length = 451 | Back alignment and structure |
| >pdb|3QVC|A Chain A, Crystal Structure Of Histo-Aspartic Protease (Hap) Zymogen From Plasmodium Falciparum Length = 451 | Back alignment and structure |
| >pdb|1EAG|A Chain A, Secreted Aspartic Proteinase (Sap2) From Candida Albicans Complexed With A70450 Length = 342 | Back alignment and structure |
| >pdb|1ZAP|A Chain A, Secreted Aspartic Protease From C. Albicans Length = 342 | Back alignment and structure |
| >pdb|2H6S|A Chain A, Secreted Aspartic Proteinase (sap) 3 From Candida Albicans Length = 340 | Back alignment and structure |
| >pdb|1J71|A Chain A, Structure Of The Extracellular Aspartic Proteinase From Candida Tropicalis Yeast Length = 334 | Back alignment and structure |
| >pdb|2QZW|A Chain A, Secreted Aspartic Proteinase (Sap) 1 From Candida Albicans Length = 341 | Back alignment and structure |
| >pdb|1WKR|A Chain A, Crystal Structure Of Aspartic Proteinase From Irpex Lacteus Length = 340 | Back alignment and structure |
| >pdb|2QZX|A Chain A, Secreted Aspartic Proteinase (Sap) 5 From Candida Albicans Length = 342 | Back alignment and structure |
| >pdb|3FV3|A Chain A, Secreted Aspartic Protease 1 From Candida Parapsilosis In Complex With Pepstatin A Length = 339 | Back alignment and structure |
| >pdb|3BRA|A Chain A, Bace-1 Complexed With Compound 1 Length = 409 | Back alignment and structure |
| >pdb|3CIB|A Chain A, Structure Of Bace Bound To Sch727596 Length = 390 | Back alignment and structure |
| >pdb|2FDP|A Chain A, Crystal Structure Of Beta-Secretase Complexed With An Amino- Ethylene Inhibitor Length = 388 | Back alignment and structure |
| >pdb|1FKN|A Chain A, Structure Of Beta-Secretase Complexed With Inhibitor Length = 391 | Back alignment and structure |
| >pdb|4EWO|A Chain A, Design And Synthesis Of Potent Hydroxyethylamine (Hea) Bace-1 Inhibitors Length = 386 | Back alignment and structure |
| >pdb|3VV6|A Chain A, Crystal Structure Of Beta Secetase In Complex With 2-Amino-3-Methyl-6- ((1s, 2r)-2-Phenylcyclopropyl)pyrimidin-4(3h)-One Length = 416 | Back alignment and structure |
| >pdb|4DPF|A Chain A, Bace-1 In Complex With A Hea-Macrocyclic Type Inhibitor Length = 391 | Back alignment and structure |
| >pdb|1W50|A Chain A, Apo Structure Of Bace (beta Secretase) Length = 411 | Back alignment and structure |
| >pdb|2ZJN|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-[1-(5-Chloro-2-Isopropoxy-3-Methoxy-Benzyl)- Piperidin-4-Yl]-2-(2-Methyl-4-Sulfamoyl-Phenoxy)- Acetamide Length = 405 | Back alignment and structure |
| >pdb|2WJO|A Chain A, Human Bace (Beta Secretase) In Complex With Cyclohexanecarboxylic Acid (2-(2-Am Ino-6-Phenoxy-4h- Quinazolin-3-Yl)-2-Cyclohexyl-Ethyl)-Amide Length = 412 | Back alignment and structure |
| >pdb|2ZJH|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-(1-Benzyl-Piperidin-4-Yl)-4-Mercapto-Butyramide Length = 405 | Back alignment and structure |
| >pdb|3CKP|A Chain A, Crystal Structure Of Bace-1 In Complex With Inhibitor Length = 412 | Back alignment and structure |
| >pdb|2HM1|A Chain A, Crystal Structure Of Human Beta-Secretase (Bace) In The Presence Of An Inhibitor (2) Length = 406 | Back alignment and structure |
| >pdb|3EXO|A Chain A, Crystal Structure Of Bace1 Bound To Inhibitor Length = 413 | Back alignment and structure |
| >pdb|3KMX|A Chain A, Structure Of Bace Bound To Sch346572 Length = 395 | Back alignment and structure |
| >pdb|2ZHR|A Chain A, Crystal Structure Of Bace1 In Complex With Om99-2 At Ph 5.0 Length = 411 | Back alignment and structure |
| >pdb|3UDH|A Chain A, Crystal Structure Of Bace With Compound 1 Length = 404 | Back alignment and structure |
| >pdb|3R1G|B Chain B, Structure Basis Of Allosteric Inhibition Of Bace1 By An Exosite- Binding Antibody Length = 402 | Back alignment and structure |
| >pdb|1TQF|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Inhibitor Length = 405 | Back alignment and structure |
| >pdb|3U6A|A Chain A, Rational Design And Synthesis Of Aminopiperazinones As Beta Secretase (Bace) Inhibitors Length = 390 | Back alignment and structure |
| >pdb|1SGZ|A Chain A, Crystal Structure Of Unbound Beta-Secretase Catalytic Domain. Length = 389 | Back alignment and structure |
| >pdb|3L58|A Chain A, Structure Of Bace Bound To Sch589432 Length = 414 | Back alignment and structure |
| >pdb|2ZJK|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With 4-(4-Fluoro-Benzyl)-Piperazine-2-Carboxylic Acid(3-Mercapto-Propyl)-Amide Length = 405 | Back alignment and structure |
| >pdb|2ZJI|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With N-[1-(2, 6-Dimethoxy-Benzyl)-Piperidin-4-Yl]-4-Mercapto- Butyramide Length = 405 | Back alignment and structure |
| >pdb|3DM6|A Chain A, Beta-Secretase 1 Complexed With Statine-Based Inhibitor Length = 406 | Back alignment and structure |
| >pdb|3IXK|A Chain A, Potent Beta-Secretase 1 Inhibitor Length = 405 | Back alignment and structure |
| >pdb|2QK5|A Chain A, Structure Of Bace1 Bound To Sch626485 Length = 395 | Back alignment and structure |
| >pdb|4B1D|A Chain A, New Aminoimidazoles As Bace-1 Inhibitors: From Rational Design To Ab-Lowering In Brain Length = 388 | Back alignment and structure |
| >pdb|3TPJ|A Chain A, Apo Structure Of Bace1 Length = 433 | Back alignment and structure |
| >pdb|3HVG|A Chain A, Structure Of Bace (Beta Secretase) In Complex With Ev0 Length = 411 | Back alignment and structure |
| >pdb|2QZL|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Ixs Length = 411 | Back alignment and structure |
| >pdb|1YM2|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Nvp-Aur200 Length = 402 | Back alignment and structure |
| >pdb|1YM4|A Chain A, Crystal Structure Of Human Beta Secretase Complexed With Nvp-Amk640 Length = 408 | Back alignment and structure |
| >pdb|3QI1|A Chain A, Design And Synthesis Of Hydroxyethylamine (Hea) Bace-1 Inhibitors: Prime Side Chromane-Containing Inhibitors Length = 408 | Back alignment and structure |
| >pdb|2QU2|A Chain A, Bace1 With Compound 1 Length = 415 | Back alignment and structure |
| >pdb|2OF0|A Chain A, X-Ray Crystal Structure Of Beta Secretase Complexed With Compound 5 Length = 402 | Back alignment and structure |
| >pdb|3TPR|A Chain A, Crystal Structure Of Bace1 Complexed With An Inhibitor Length = 433 | Back alignment and structure |
| >pdb|2VA5|A Chain A, X-Ray Crystal Structure Of Beta Secretase Complexed With Compound 8c Length = 455 | Back alignment and structure |
| >pdb|3LPI|A Chain A, Structure Of Bace Bound To Sch745132 Length = 455 | Back alignment and structure |
| >pdb|2HIZ|A Chain A, Crystal Structure Of Human Beta-Secretase (Bace) In The Presence Of An Inhibitor Length = 455 | Back alignment and structure |
| >pdb|2Q11|A Chain A, Structure Of Bace Complexed To Compound 1 Length = 388 | Back alignment and structure |
| >pdb|2Q15|A Chain A, Structure Of Bace Complexed To Compound 3a Length = 385 | Back alignment and structure |
| >pdb|2VIE|A Chain A, Human Bace-1 In Complex With N-((1s,2r)-1-Benzyl-2-Hydroxy- 3-((1,1, 5-Trimethylhexyl)amino)propyl)-3-(Ethylamino)-5-(2- Oxopyrrolidin-1-Yl)benzamide Length = 392 | Back alignment and structure |
| >pdb|2ZJJ|A Chain A, Crystal Structure Of The Human Bace1 Catalytic Domain In Complex With 4-(4-Fluoro-Benzyl)-Piperazine-2-Carboxylic Acid (2-Mercapto-Ethyl)- Amide Length = 405 | Back alignment and structure |
| >pdb|2RMP|A Chain A, Rmp-Pepstatin A Complex Length = 361 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 412 | |||
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 1e-163 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 1e-90 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 3e-88 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 5e-36 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 4e-88 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 2e-36 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 3e-85 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 9e-36 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 1e-84 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 5e-29 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 5e-83 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 3e-37 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 1e-82 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 8e-38 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 2e-82 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 3e-34 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 8e-82 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 5e-37 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 4e-81 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 1e-29 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 8e-78 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 6e-26 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 1e-77 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 1e-32 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 4e-77 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 1e-34 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 4e-77 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 8e-31 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 1e-76 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 1e-26 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 1e-76 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 3e-39 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 5e-76 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 1e-22 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 5e-74 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 2e-29 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 8e-71 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 6e-23 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 2e-70 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 7e-25 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 8e-70 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 9e-23 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 6e-69 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 2e-24 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 6e-69 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 6e-23 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 1e-68 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 2e-26 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 2e-67 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 9e-19 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 3e-65 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 1e-24 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 4e-65 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 4e-25 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 2e-64 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 2e-25 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 8e-63 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 2e-23 | |
| 3rfi_A | 108 | Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuber | 4e-41 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 1e-40 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 7e-14 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 1e-08 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 7e-14 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 8e-09 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 2e-13 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 2e-08 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 1e-09 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 5e-07 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 1e-08 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 6e-07 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 2e-07 | |
| 1lya_A | 97 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 4e-07 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 6e-07 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 3e-06 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 4e-05 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 1e-04 |
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Length = 478 | Back alignment and structure |
|---|
Score = 465 bits (1199), Expect = e-163
Identities = 240/370 (64%), Positives = 297/370 (80%), Gaps = 3/370 (0%)
Query: 46 GKSCEINYGSGSISGFFSQDNVEVGDVVVKDQVFIEATREGSLTFLLARFDGIIGLGFRE 105
GK I YG+GSI+G+FS+D+V VGD+VVKDQ FIEAT+E +TFL+A+FDGI+GLGF+E
Sbjct: 109 GKPAAIQYGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLGFKE 168
Query: 106 IAVGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVT 165
I+VG AVPVW M+EQGLVS+ VFSFWLNR D EGGEI+FGG+DPKH+ G+HTYVPVT
Sbjct: 169 ISVGKAVPVWYKMIEQGLVSDPVFSFWLNRHVDEGEGGEIIFGGMDPKHYVGEHTYVPVT 228
Query: 166 KKGYWQFELGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVVSAE 225
+KGYWQF++GD+L+G +STG C GGCAAI DSGTSLLAGPT ++TEIN IG GVVS E
Sbjct: 229 QKGYWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQE 288
Query: 226 CKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEK---ENVSAGD 282
CK +VSQYG I DLL++ P+K+C Q+GLC F+G VS GI++VV+ ++
Sbjct: 289 CKTIVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLRA 348
Query: 283 SAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSF 342
+CSACEMAVVW+QNQL Q +T++ +L Y+N+LC+ LP+PMGES +DC + +MP++ F
Sbjct: 349 DPMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCGSLGSMPDIEF 408
Query: 343 TIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSG 402
TIG K F L PE+YILK GEG A CISGF A D+PPPRGPLWILGDVFMG YHTVFD G
Sbjct: 409 TIGGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYG 468
Query: 403 KLRIGFAEAA 412
KLRIGFA+AA
Sbjct: 469 KLRIGFAKAA 478
|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 239 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Length = 329 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Length = 351 | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Length = 329 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Length = 323 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Length = 370 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Length = 324 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Length = 341 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Length = 330 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Length = 361 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Length = 375 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Length = 453 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Length = 451 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Length = 325 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Length = 241 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Length = 383 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Length = 340 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Length = 455 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Length = 329 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Length = 395 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Length = 342 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Length = 329 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Length = 342 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Length = 334 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} PDB: 3tne_A* Length = 339 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Length = 323 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Length = 325 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Length = 323 | Back alignment and structure |
|---|
| >3rfi_A Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuberosum} Length = 108 | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Length = 87 | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A Length = 91 | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A Length = 91 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A Length = 80 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A Length = 80 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A Length = 83 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A Length = 83 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Length = 403 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* Length = 83 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* Length = 83 | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 Length = 78 | Back alignment and structure |
|---|
| >1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Length = 97 | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Length = 413 | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Length = 381 | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Length = 381 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 Length = 81 | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A Length = 99 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 412 | |||
| 1qdm_A | 478 | Prophytepsin; aspartic proteinases, saposin-like d | 100.0 | |
| 2x0b_A | 383 | Renin; hydrolase-hormone complex, hydrolase hormon | 100.0 | |
| 3psg_A | 370 | Pepsinogen; hydrolase(acid proteinase zymogen); 1. | 100.0 | |
| 1tzs_A | 351 | Cathepsin E; hydrolase, aspartic protease, activat | 100.0 | |
| 3k1w_A | 341 | Renin; protease, alternative splicing, aspartyl pr | 100.0 | |
| 1htr_B | 329 | Gastricsin; aspartyl protease; 1.62A {Homo sapiens | 100.0 | |
| 3cms_A | 323 | Chymosin B; hydrolase, acid proteinase; 2.00A {Bos | 100.0 | |
| 1dpj_A | 329 | Proteinase A; proteinase A, hydrolase-hydrolase in | 100.0 | |
| 4aa9_A | 320 | Chymosin; hydrolase, aspartic peptidase, rennet; H | 100.0 | |
| 1am5_A | 324 | Pepsin, acid proteinase; aspartyl protease, hydrol | 100.0 | |
| 1yg9_A | 330 | Aspartic protease BLA G 2; allegren, hydrolase, al | 100.0 | |
| 1miq_A | 375 | Plasmepsin; aspartic proteinase zymogen, domain op | 100.0 | |
| 3qvc_A | 451 | Histo-aspartic protease; HAP, plasmepsin, zymogen, | 100.0 | |
| 1mpp_A | 361 | Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu | 100.0 | |
| 2bju_A | 453 | Plasmepsin II; aspartic proteinase, drug design, m | 100.0 | |
| 3c9x_A | 329 | Trichoderma reesei aspartic protease; aspartic pro | 100.0 | |
| 2apr_A | 325 | Rhizopuspepsin; hydrolase (aspartic proteinase); 1 | 100.0 | |
| 1oew_A | 329 | Endothiapepsin; hydrolase, aspartic proteinase mec | 100.0 | |
| 1ibq_A | 325 | Aspergillopepsin; aspartic proteinase, hydrolase; | 100.0 | |
| 1izd_A | 323 | Aspartic proteinase; sugar binding, acid protease, | 100.0 | |
| 1bxo_A | 323 | Protein (penicillopepsin); hydrolase, phosphonate | 100.0 | |
| 3fv3_A | 339 | SAPP1P-secreted aspartic protease 1; secreted aspa | 100.0 | |
| 2qzx_A | 342 | Candidapepsin-5; aspartic proteinase, aspartyl pro | 100.0 | |
| 3pvk_A | 342 | Candidapepsin-2; hydrolase; 1.27A {Candida albican | 100.0 | |
| 1j71_A | 334 | Candidapepsin, aspartic proteinase; candida tropic | 100.0 | |
| 1wkr_A | 340 | Polyporopepsin; hydrolase, hydrolase-hydrolase inh | 100.0 | |
| 2ewy_A | 383 | Beta-secretase 2; BACE2, aspartic protease, hydrol | 100.0 | |
| 3vf3_A | 402 | Beta-secretase 1; structure-based drug design, hyd | 100.0 | |
| 3lpj_A | 455 | Beta-secretase 1; alzheimer'S, aspartyl protease, | 100.0 | |
| 2qp8_A | 395 | Beta-secretase 1; BACE1, protease, alternative spl | 100.0 | |
| 1lya_B | 241 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 100.0 | |
| 3aup_A | 403 | SBG7S, BG, basic 7S globulin; pepsin-like fold, pl | 100.0 | |
| 3vla_A | 413 | EDGP; extracellular, inhibitor, plant protein; HET | 100.0 | |
| 1t6e_X | 381 | Xylanase inhibitor; two beta-barrel domain structu | 100.0 | |
| 1b5f_A | 239 | Protein (cardosin A); hydrolase, aspartic proteina | 100.0 | |
| 1b5f_B | 87 | Protein (cardosin A); hydrolase, aspartic proteina | 99.82 | |
| 3rfi_A | 108 | Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuber | 99.8 | |
| 1lya_A | 97 | Cathepsin D; lysosomal aspartic protease; HET: NAG | 99.4 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 97.75 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 97.72 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 97.68 | |
| 1l9l_A | 74 | Granulysin; saposin fold, membrane-lytic, antimicr | 97.63 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 97.61 | |
| 1of9_A | 77 | Pore-forming peptide ameobapore A; toxin, saplip, | 97.53 | |
| 2qyp_A | 91 | Proactivator polypeptide; saposin, activator prote | 97.53 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 97.44 | |
| 3bqp_A | 80 | Proactivator polypeptide; saposin, sphingolipid ac | 97.44 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 97.32 | |
| 1n69_A | 81 | Saposin B; lipid binding protein, glycosphingolipi | 97.25 | |
| 2gtg_A | 83 | Proactivator polypeptide; saposin, sphingolipid ac | 97.19 | |
| 1nkl_A | 78 | NK-lysin; saposin fold, antibacterial peptide, tum | 97.14 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 97.08 | |
| 2js9_A | 99 | Saposin-like protein family protein 5; caenopore-5 | 97.07 | |
| 1of9_A | 77 | Pore-forming peptide ameobapore A; toxin, saplip, | 97.05 | |
| 4ddj_A | 83 | Saposin-A, protein A; saposin fold, sphingolipid a | 96.73 | |
| 1l9l_A | 74 | Granulysin; saposin fold, membrane-lytic, antimicr | 96.32 | |
| 3s64_A | 87 | AC-SLP-1, saposin-like protein 1; lipid-binding, l | 94.83 | |
| 3s64_A | 87 | AC-SLP-1, saposin-like protein 1; lipid-binding, l | 81.39 |
| >1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-77 Score=622.28 Aligned_cols=411 Identities=60% Similarity=1.084 Sum_probs=359.1
Q ss_pred cccccceeeecCccCccceEEecC-C----CCCCCCCCCCCCCCceEECCcEEEEEEcCceEEEEEEEEEEEECCeEEee
Q 015145 2 LNTLERLVLALPHKISVSYLIPAV-P----ISGFHLQSAISLFPAISIRGKSCEINYGSGSISGFFSQDNVEVGDVVVKD 76 (412)
Q Consensus 2 ~~t~~~~~~~~p~t~s~~~wvp~~-~----~c~~~~~y~p~~Sst~~~~~~~~~i~Y~~gs~~G~~~~D~v~lg~~~~~~ 76 (412)
+|||+|.+.+..||||+++|||+. + .|..|+.|+|++|+|++..+++|++.|++|++.|++++|+|++++..+.+
T Consensus 60 IGTP~Q~~~v~~DTGSs~lWV~~~~C~~~~~C~~~~~y~~~~SsT~~~~~~~~~i~Yg~Gs~~G~~~~Dtv~ig~~~v~~ 139 (478)
T 1qdm_A 60 VGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYKAGASSTYKKNGKPAAIQYGTGSIAGYFSEDSVTVGDLVVKD 139 (478)
T ss_dssp ETTTTEEEEEEEETTCCCCEEEBTTCCSCGGGGGSCCBCGGGCTTCBCCCCEEEEEETTEEEEEEEEEEEEEETTEEEEE
T ss_pred ECCCCeEEEEEEcCCCcceEEecCCCCCCccccCCCCCCcccCCCeeeCCcEEEEEcCCCCeEEEEEEEEEEECCeEECC
Confidence 689999999999999999999986 2 58889999999999999999999999999999999999999999999999
Q ss_pred eEEEEEEeecCcccccCCccEEEeccCCccccCCCCchHHHHHHcCCCCCCeEEEEecCCCCCCCCcEEEeCCCCCCCee
Q 015145 77 QVFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFK 156 (412)
Q Consensus 77 ~~fg~~~~~~~~~~~~~~~dGilGLg~~~~s~~~~~~~~~~L~~qg~i~~~~Fsl~l~~~~~~~~~G~l~fGg~D~~~~~ 156 (412)
+.||++....+..|....++||||||++.++.....|++++|++||+|.+++||+||++..+...+|.|+|||+|+++|.
T Consensus 140 ~~Fg~a~~~~~~~f~~~~~dGIlGLg~~~~s~~~~~p~~~~l~~qg~i~~~~FS~~L~~~~~~~~~G~l~fGg~d~~~~~ 219 (478)
T 1qdm_A 140 QEFIEATKEPGITFLVAKFDGILGLGFKEISVGKAVPVWYKMIEQGLVSDPVFSFWLNRHVDEGEGGEIIFGGMDPKHYV 219 (478)
T ss_dssp EEEEEEEECCBSHHHHCSSSEEEECSCGGGCGGGCCCHHHHHTTTTCCSSSEEEEECCCC-----CEEEEETCCCTTSEE
T ss_pred EEEEEEEecCCcccccccccceecccccccccCCCCcHHHHHHHCCCCCCCEEEEEeecCCCCCCCeEEEeCCcCHhhcC
Confidence 99999998766556667889999999998887677889999999999999999999998754445899999999999999
Q ss_pred cCceEeeccccceeEEEEceEEECCeeeceecCCceEEEcCCCCCcccCHHHHHHHHHHhCCCceeecchhhhhhhchhh
Q 015145 157 GKHTYVPVTKKGYWQFELGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVVSAECKLVVSQYGDL 236 (412)
Q Consensus 157 g~l~~~p~~~~~~w~v~~~~i~v~~~~~~~~~~~~~~ivDSGts~i~lP~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~ 236 (412)
|++.|+|+.+.++|.|.+++|.++++.+.++.....++|||||+++++|.+++++|.+++++.++++.+||.++++|++.
T Consensus 220 G~l~~~pv~~~~~w~v~l~~i~v~g~~~~~~~~~~~aiiDTGTs~~~lP~~~~~~i~~~i~a~~~~s~~Ck~~v~~yg~~ 299 (478)
T 1qdm_A 220 GEHTYVPVTQKGYWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQECKTIVSQYGQQ 299 (478)
T ss_dssp EEEEEEEEEEETTEEEEECCEEETTEECSTTTTCEEEEECSSCCSEEECHHHHHHHHHHHTCCCBCCHHHHHHHHHTHHH
T ss_pred CCceEEeccCCCeEEEEEeEEEECCEEEeecCCCceEEEcCCCCceeCCHHHHHHHHHHhCccccccccccchhhhhhhH
Confidence 99999999999999999999999999876666778999999999999999999999999999999999999999999999
Q ss_pred HHHHHhhCCCccchhhcccccccCCcceeccceeeeeecccc---ccCCcccchhhhhHHHHHHhhhhhhhhHHHHHHHh
Q 015145 237 IWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENV---SAGDSAVCSACEMAVVWVQNQLKQKQTKEKVLSYI 313 (412)
Q Consensus 237 ~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~ 313 (412)
||++|.++..|+++|.+.|+|..++.+..++.+..+.+|++. ...++..|++|||+|.|++++|++|+|+++|++++
T Consensus 300 ii~~l~~~~~p~~vC~~iglC~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~C~~Ce~~v~~~~~~l~~n~t~~~I~~~~ 379 (478)
T 1qdm_A 300 ILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLRADPMCSACEMAVVWMQNQLAQNKTQDLILDYV 379 (478)
T ss_dssp HHHHHHTTCCHHHHHHHTTCC---------------------------CHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHH
T ss_pred HHHhhhhccChhhhhccccccccCccccccccccccccccccccccccccccchHHHHHHHHHHHHHhccccHHHHHHHH
Confidence 999999999999999999999999988888888887777543 45678899999999999999999999999999999
Q ss_pred hhhccCCCCCCCceeeeCCCCCCCCcEEEEECCEEEEeCcccceEEeccccccceeeeeeeccCCCCCCCcEEEcccccc
Q 015145 314 NELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMG 393 (412)
Q Consensus 314 ~~~c~~~~~~~~~~~ipC~~~~~lp~l~f~~gg~~~~i~p~~yl~~~~~~~~~~C~~~i~~~~~~~~~~~~~iLG~~fl~ 393 (412)
+++|.+++...|.|.++|+.+..+|+|+|+|+|+.|+|+|++|+++..++....|+++|...+.+++.++.||||++|||
T Consensus 380 ~~~C~~~~~~~g~~~v~C~~~~~lP~i~f~~gg~~~~l~p~~yi~~~~~~~~~~C~~~~~~~~~~~~~~~~~ILGd~fl~ 459 (478)
T 1qdm_A 380 NQLCNRLPSPMGESAVDCGSLGSMPDIEFTIGGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMG 459 (478)
T ss_dssp HHHTTCBCCSSSCCEECGGGGTTCCCEEEEETTEEEEECHHHHEEECSCGGGCCEEESEEECCCCTTSCSEEEECHHHHT
T ss_pred HHHhhccCCCCCeEEeecccccccccEEEEECCEEEEEChHHhEEEccCCCCCeEEEEEEeccCCCCCCCcEEECHHHhc
Confidence 99999999999999999998889999999999999999999999987655466899999988766556789999999999
Q ss_pred ceEEEEeCCCCeEEEEecC
Q 015145 394 VYHTVFDSGKLRIGFAEAA 412 (412)
Q Consensus 394 ~~yvvfD~e~~rIGfa~~~ 412 (412)
++|+|||++++|||||+++
T Consensus 460 ~~y~vfD~~~~rIGfA~a~ 478 (478)
T 1qdm_A 460 PYHTVFDYGKLRIGFAKAA 478 (478)
T ss_dssp TEEEEEETTTTEEEEEEEC
T ss_pred cEEEEEECCCCEEEEEeCC
Confidence 9999999999999999986
|
| >2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A | Back alignment and structure |
|---|
| >1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... | Back alignment and structure |
|---|
| >1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A | Back alignment and structure |
|---|
| >3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A | Back alignment and structure |
|---|
| >1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* | Back alignment and structure |
|---|
| >4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A | Back alignment and structure |
|---|
| >1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* | Back alignment and structure |
|---|
| >1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* | Back alignment and structure |
|---|
| >3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* | Back alignment and structure |
|---|
| >1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* | Back alignment and structure |
|---|
| >2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... | Back alignment and structure |
|---|
| >3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* | Back alignment and structure |
|---|
| >2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A | Back alignment and structure |
|---|
| >1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... | Back alignment and structure |
|---|
| >1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* | Back alignment and structure |
|---|
| >1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A | Back alignment and structure |
|---|
| >3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* | Back alignment and structure |
|---|
| >2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} | Back alignment and structure |
|---|
| >3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* | Back alignment and structure |
|---|
| >1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... | Back alignment and structure |
|---|
| >3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* | Back alignment and structure |
|---|
| >2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... | Back alignment and structure |
|---|
| >1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* | Back alignment and structure |
|---|
| >3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} | Back alignment and structure |
|---|
| >3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A | Back alignment and structure |
|---|
| >1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A | Back alignment and structure |
|---|
| >1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >1b5f_B Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 | Back alignment and structure |
|---|
| >3rfi_A Asp; PSI, saposin, hydrolase; 1.90A {Solanum tuberosum} | Back alignment and structure |
|---|
| >1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A | Back alignment and structure |
|---|
| >1l9l_A Granulysin; saposin fold, membrane-lytic, antimicrobial protein; HET: MPO; 0.92A {Homo sapiens} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A | Back alignment and structure |
|---|
| >1of9_A Pore-forming peptide ameobapore A; toxin, saplip, amoebapore A; NMR {Entamoeba histolytica} SCOP: a.64.1.4 | Back alignment and structure |
|---|
| >2qyp_A Proactivator polypeptide; saposin, activator protein, alternative splicing, disease mutation, gaucher disease, glycoprotein, GM2- gangliosidosis; 2.45A {Homo sapiens} SCOP: a.64.1.1 PDB: 2z9a_A | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >3bqp_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid binding protein, acid ceramidase,farber disease, lipid metabolism; 1.30A {Homo sapiens} PDB: 3bqq_C 2rb3_A 2r1q_A 2r0r_A | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 | Back alignment and structure |
|---|
| >1n69_A Saposin B; lipid binding protein, glycosphingolipid activator protein; HET: PEH; 2.20A {Homo sapiens} SCOP: a.64.1.3 | Back alignment and structure |
|---|
| >2gtg_A Proactivator polypeptide; saposin, sphingolipid activator protein, lipid-binding prote binding protein; 2.40A {Homo sapiens} SCOP: a.64.1.1 PDB: 1m12_A 1sn6_A | Back alignment and structure |
|---|
| >1nkl_A NK-lysin; saposin fold, antibacterial peptide, tumourolytic peptide; NMR {Sus scrofa} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A | Back alignment and structure |
|---|
| >2js9_A Saposin-like protein family protein 5; caenopore-5, saposin-like fold, antimicrobial protein; NMR {Caenorhabditis elegans} PDB: 2jsa_A | Back alignment and structure |
|---|
| >1of9_A Pore-forming peptide ameobapore A; toxin, saplip, amoebapore A; NMR {Entamoeba histolytica} SCOP: a.64.1.4 | Back alignment and structure |
|---|
| >4ddj_A Saposin-A, protein A; saposin fold, sphingolipid activator protein, galactosylcera lauryldimethylamine-N-oxide, lipid, detergent, lysosome; HET: LDA; 1.90A {Homo sapiens} PDB: 2dob_A* | Back alignment and structure |
|---|
| >1l9l_A Granulysin; saposin fold, membrane-lytic, antimicrobial protein; HET: MPO; 0.92A {Homo sapiens} SCOP: a.64.1.1 | Back alignment and structure |
|---|
| >3s64_A AC-SLP-1, saposin-like protein 1; lipid-binding, lipid binding protein; HET: CIT EPE; 2.30A {Ancylostoma caninum} | Back alignment and structure |
|---|
| >3s64_A AC-SLP-1, saposin-like protein 1; lipid-binding, lipid binding protein; HET: CIT EPE; 2.30A {Ancylostoma caninum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 412 | ||||
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 2e-36 | |
| g1htr.1 | 372 | b.50.1.2 (P:,B:) Pepsin(ogen) {Human (Homo sapiens | 2e-25 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 4e-36 | |
| d1smra_ | 335 | b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mu | 7e-27 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 5e-35 | |
| d1dpja_ | 329 | b.50.1.2 (A:) Acid protease {Baker's yeast (Saccha | 4e-24 | |
| d1qdma1 | 104 | a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Horde | 7e-35 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 3e-34 | |
| d1qdma2 | 337 | b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase | 5e-29 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 4e-34 | |
| g1b5f.1 | 326 | b.50.1.2 (A:,B:) Plant acid proteinase, phytepsin | 2e-25 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 2e-32 | |
| g1lya.1 | 338 | b.50.1.2 (A:,B:) Cathepsin D {Human (Homo sapiens) | 2e-26 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 4e-32 | |
| d1hrna_ | 337 | b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Ho | 5e-26 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 5e-32 | |
| d3psga_ | 370 | b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxI | 1e-27 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 9e-32 | |
| d2qp8a1 | 387 | b.50.1.2 (A:60-446) beta-secretase (memapsin) {Hum | 3e-14 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 8e-31 | |
| d1am5a_ | 324 | b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus mo | 2e-23 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 2e-30 | |
| d1wkra_ | 340 | b.50.1.2 (A:) Acid protease {Irpex lacteus (Polypo | 4e-19 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 3e-30 | |
| d1mppa_ | 357 | b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840] | 2e-15 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 3e-29 | |
| d3cmsa_ | 323 | b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos | 4e-20 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 2e-27 | |
| d1eaga_ | 342 | b.50.1.2 (A:) Acid protease {Yeast (Candida albica | 2e-14 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 1e-25 | |
| d1j71a_ | 334 | b.50.1.2 (A:) Acid protease {Yeast (Candida tropic | 4e-14 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 1e-25 | |
| d2bjua1 | 329 | b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrad | 1e-21 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 8e-25 | |
| d2apra_ | 325 | b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus | 8e-20 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 1e-23 | |
| d1miqa_ | 373 | b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading e | 2e-23 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 3e-23 | |
| d1oewa_ | 330 | b.50.1.2 (A:) Endothiapepsin {Chestnut blight fung | 7e-16 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 1e-22 | |
| d1izea_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Aspergillus o | 2e-17 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 2e-18 | |
| d1t6ex_ | 381 | b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Tr | 5e-18 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 2e-17 | |
| d1bxoa_ | 323 | b.50.1.2 (A:) Acid protease {Fungus (Penicillium j | 7e-17 | |
| d1of9a_ | 77 | a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica | 1e-12 | |
| d1of9a_ | 77 | a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica | 0.001 | |
| d2gtga1 | 78 | a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) | 4e-12 | |
| d2gtga1 | 78 | a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) | 6e-09 | |
| d1nkla_ | 78 | a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [Tax | 2e-11 | |
| d1nkla_ | 78 | a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [Tax | 1e-05 | |
| d1n69a_ | 78 | a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [Tax | 3e-07 | |
| d1n69a_ | 78 | a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [Tax | 4e-04 | |
| d1l9la_ | 74 | a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Hom | 3e-06 | |
| d1l9la_ | 74 | a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Hom | 0.003 |
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Length = 335 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Length = 329 | Back information, alignment and structure |
|---|
| >d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 337 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Length = 370 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Length = 387 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Length = 324 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Length = 340 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Length = 357 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Length = 323 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Length = 342 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 334 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Length = 329 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Length = 325 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Length = 373 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Length = 330 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Length = 323 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 381 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Length = 323 | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} Length = 77 | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} Length = 77 | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 412 | |||
| g1htr.1 | 372 | Pepsin(ogen) {Human (Homo sapiens), progastricsin | 100.0 | |
| d3psga_ | 370 | Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1dpja_ | 329 | Acid protease {Baker's yeast (Saccharomyces cerevi | 100.0 | |
| d1smra_ | 335 | Chymosin (synonym: renin) {Mouse (Mus musculus) [T | 100.0 | |
| d2apra_ | 325 | Acid protease {Bread mold (Rhizopus chinensis) [Ta | 100.0 | |
| d1hrna_ | 337 | Chymosin (synonym: renin) {Human (Homo sapiens) [T | 100.0 | |
| d1am5a_ | 324 | Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: | 100.0 | |
| d1miqa_ | 373 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 100.0 | |
| d1oewa_ | 330 | Endothiapepsin {Chestnut blight fungus (Endothia p | 100.0 | |
| d1j71a_ | 334 | Acid protease {Yeast (Candida tropicalis) [TaxId: | 100.0 | |
| g1lya.1 | 338 | Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1qdma2 | 337 | Plant acid proteinase, phytepsin {Barley (Hordeum | 100.0 | |
| d1eaga_ | 342 | Acid protease {Yeast (Candida albicans) [TaxId: 54 | 100.0 | |
| d1mppa_ | 357 | Pepsin {Mucor pusillus [TaxId: 4840]} | 100.0 | |
| g1b5f.1 | 326 | Plant acid proteinase, phytepsin {Cynara carduncul | 100.0 | |
| d1izea_ | 323 | Acid protease {Fungus (Aspergillus oryzae) [TaxId: | 100.0 | |
| d2bjua1 | 329 | Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo | 100.0 | |
| d1bxoa_ | 323 | Acid protease {Fungus (Penicillium janthinellum), | 100.0 | |
| d1wkra_ | 340 | Acid protease {Irpex lacteus (Polyporus tulipifera | 100.0 | |
| d3cmsa_ | 323 | Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId | 100.0 | |
| d2qp8a1 | 387 | beta-secretase (memapsin) {Human (Homo sapiens) [T | 100.0 | |
| d1t6ex_ | 381 | Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu | 100.0 | |
| d1qdma1 | 104 | (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4 | 99.65 | |
| d2gtga1 | 78 | Saposin C {Human (Homo sapiens) [TaxId: 9606]} | 97.41 | |
| d1of9a_ | 77 | Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | 97.15 | |
| d1of9a_ | 77 | Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | 97.13 | |
| d2gtga1 | 78 | Saposin C {Human (Homo sapiens) [TaxId: 9606]} | 96.98 | |
| d1n69a_ | 78 | Saposin B {Human (Homo sapiens) [TaxId: 9606]} | 96.95 | |
| d1nkla_ | 78 | NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | 96.93 | |
| d1nkla_ | 78 | NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | 96.87 | |
| d1n69a_ | 78 | Saposin B {Human (Homo sapiens) [TaxId: 9606]} | 96.72 | |
| d1l9la_ | 74 | Granulysin, NKG5 protein {Human (Homo sapiens) [Ta | 96.38 | |
| d1l9la_ | 74 | Granulysin, NKG5 protein {Human (Homo sapiens) [Ta | 95.79 |
| >d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} | Back information, alignment and structure |
|---|
| >d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} | Back information, alignment and structure |
|---|
| >d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} | Back information, alignment and structure |
|---|
| >d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} | Back information, alignment and structure |
|---|
| >d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} | Back information, alignment and structure |
|---|
| >d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1of9a_ a.64.1.4 (A:) Ameobapore A {Entamoeba histolytica [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d2gtga1 a.64.1.1 (A:2-79) Saposin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nkla_ a.64.1.1 (A:) NK-lysin, NKL {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1n69a_ a.64.1.3 (A:) Saposin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l9la_ a.64.1.1 (A:) Granulysin, NKG5 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|