Citrus Sinensis ID: 015150

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--
MPMVRRSAATNLGKFAATVEAAHLKSEIMSIFEELTQDDQDSVRLLAVEGCGALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKDQVMMSG
ccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccc
MPMVRRSAATNLGKFAATVEAAHLKSEIMSIFEELTQDDQDSVRLLAVEGCGALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKDQVMM**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPMVRRSAATNLGKFAATVEAAHLKSEIMSIFEELTQDDQDSVRLLAVEGCGALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKDQVMMSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform The A subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. Involved during developmental process such as seedling and floral developments. Seems to act as a negative regulator of PP2A catalytic activity.confidentQ38950
Protein phosphatase PP2A regulatory subunit A (Fragment) The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.probableP36875
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. Required for proper chromosome segregation and for centromeric localization of SGOL1 in mitosis.probableQ32PI5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B3U, chain A
Confidence level:very confident
Coverage over the Query: 1-407
View the alignment between query and template
View the model in PyMOL