Citrus Sinensis ID: 015168

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--

MGFFSKLILIVGGPLVGKLMDHSPRIPAYICLNTVQAAAQLLSAAMIIHAHTVIPTSSSMLLHPWFFVLVLAGAVERLTGVALGVAVERDWAVLLAGINRPIALAKANAVLNRIDLLCEIAGASLFGILLSKYEPVTCLKFAAGLIMWSLPVMIILTWFTNKISSGVLDRAKCSQSCCRTSNEGPVPDADNIVDVGIEAIKLGWKEYMQQPVLPASLAYVLLCLNVVLTPGSLMTAFLTQRGLNPSIIGGFSGLCASMGVAATFLSAYLVRRLGILKAGAAGLIFQASLLAMAVAVYWSGSLSQQNPLLFFLCLIVLSRLGHMSYDIVGAQILQTGIPSSKANLIGTTEISVASLVESVMLGVAIIANDVSHFGFLATLSLLSVVGAAWMFCHWLLNPTDEQRSLFSFDPQS

ccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc

MGFFSKLILIVGGPLVGKLMDHSPRIPAYICLNTVQAAAQLLSAAMIIHAHTVIPTSSSMLLHPWFFVLVLAGAVERLTGVALGVAVERDWAVLLAGINRPIALAKANAVLNRIDLLCEIAGASLFGILLSKYEPVTCLKFAAGLIMWSLPVMIILTWFTNKISSGVLD*******************ADNIVDVGIEAIKLGWKEYMQQPVLPASLAYVLLCLNVVLTPGSLMTAFLTQRGLNPSIIGGFSGLCASMGVAATFLSAYLVRRLGILKAGAAGLIFQASLLAMAVAVYWSGSLSQQNPLLFFLCLIVLSRLGHMSYDIVGAQILQTGIPSSKANLIGTTEISVASLVESVMLGVAIIANDVSHFGFLATLSLLSVVGAAWMFCHWLLNPTDEQRSLF******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Solute carrier family 40 member 3, chloroplastic	Probable plastid transporter that may play a role in iron chelation, storage or sequestration under limiting iron conditions. In presence of exogenous antibiotics, may allow opportunistic entry of multiple aminoglycoside antibiotics into the chloroplast.	probable	Q8W4E7
Solute carrier family 40 member 2, chloroplastic	May be involved in iron transport and iron homeostasis.	probable	Q2QNK7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:confident
Coverage over the Query: 4-181,196-392
View the alignment between query and template
View the model in PyMOL