Citrus Sinensis ID: 015194

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-

MLLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQFTDMANPDRPLSSLNISHGSIVFLSYDGERNVRGPSFNPAGSFGRKMTMDDLIAKQMRVTRQENPHCESVSFDRDCADAFQQYVNETLAFAVKRGGFMYGTVLEDKRVEVNFIYEPPQQGTEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQNKKDYTLSNREVLQAVEFHAECNMEEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIAEGDDPKLSKMKKDVVVGGKDVKEVDNDFFLVVVKILDHQGPLSSTFPIENRTTQVTMRALKSHLNRSPSLPLVKRISDFHLLLFLARFLDLNSDVPALAQCVQAQTAVPEGYKLLINSMAETV

cEEEEEcccccEEEEEccccccHHHHHHHHHHHccccccccccccccHHHccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEcccccccccEEEEccHHHHHHHHHHHHHHHcccEEEEEcccEEcccccEEEEEEEccccccccccEEEccccHHHHHHHHHHHHccccEEEEEEEEcccccccccECcHHHHHHHHHHHHHcccccEEEEEEEEEEEcccccCEEEEEEEHHHHHHHHHHccccccccccccccccccccccEEEEcccccccccccEEEEEEEcccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHccccc

MLLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVE**********L***********************LNISHGSIVFLSYDG*****************KMTMDDLIAKQMRVTRQENPHCESVSFDRDCADAFQQYVNETLAFAVKRGGFMYGTVLEDKRVEVNFIYEPPQQGTEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQNKKDYTLSNREVLQAVEFHAECNMEEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIAE*******KMKKDVVVGGKDVKEVDNDFFLVVVKILDHQGPLSSTFPIENRTTQVTMRALKSHLNRSPSLPLVKRISDFHLLLFLARFLDLNSDVPALAQCVQAQTAVPEGYKLLINSMAETV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NPL4-like protein 1	May be part of a complex that binds ubiquitinated proteins and that is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome.	confident	Q9LYC2
NPL4-like protein	May be part of a complex that binds ubiquitinated proteins and that is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome.	probable	Q9AS33
NPL4-like protein 2	May be part of a complex that binds ubiquitinated proteins and that is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome.	probable	O82264

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WF9, chain A
Confidence level:very confident
Coverage over the Query: 1-96
View the alignment between query and template
View the model in PyMOL

Template: 3RZV, chain A
Confidence level:probable
Coverage over the Query: 126-285
View the alignment between query and template
View the model in PyMOL