Citrus Sinensis ID: 015194

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-

MLLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQFTDMANPDRPLSSLNISHGSIVFLSYDGERNVRGPSFNPAGSFGRKMTMDDLIAKQMRVTRQENPHCESVSFDRDCADAFQQYVNETLAFAVKRGGFMYGTVLEDKRVEVNFIYEPPQQGTEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQNKKDYTLSNREVLQAVEFHAECNMEEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIAEGDDPKLSKMKKDVVVGGKDVKEVDNDFFLVVVKILDHQGPLSSTFPIENRTTQVTMRALKSHLNRSPSLPLVKRISDFHLLLFLARFLDLNSDVPALAQCVQAQTAVPEGYKLLINSMAETV

cEEEEEcccccEEEEEccccccHHHHHHHHHHHccccccccccccccHHHHcccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEcccccccccEEEEcHHHHHHHHHHHHHHHHcccEEEEEcccEEcccccEEEEEEEccccccccccEEEccccHHHHHHHHHHHHccccEEEEEEEEcccccccccEEcHHHHHHHHHHHHHcccccEEEEEEEEEEEcccccEEEEEEEEHHHHHHHHHHccccccccccccccccccccccEEEEcccccccccccEEEEEEEcccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHccccc

cEEEEEcccccEEEEEccccccHHHHHHHHHHHccccccccEEccccHHcccccHHHHHcccccccccccHHHcccccccEEEEEEccccccccccccccccccccccHHHcccccEEEcccccccccEEEEccccHHHHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEccccccccccEEEcccccHHHHHHHHHHHccccEEEEEEcccccccccccEccHHHHHHHHHHHHHccccccccEEEEEEEEccccccEEEEEEEEcHHHHHHHHcccccccccccccccccEEcccEEEEccccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHccc

mllrirsrdglervtvdgAHVTVAELKTIIQSqlripvesqtlstnqnlllakspsdllqftdmanpdrplsslnishgSIVFLSydgernvrgpsfnpagsfgrkmTMDDLIAKQMRVtrqenphcesvsfdrDCADAFQQYVNETLAFAVKRGGFMYGTVLEdkrvevnfiyeppqqgtEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMqnkkdytlsNREVLQAVEFHAECNMEEWVTAVVKLEVseegsaaiHFEAFQMSDMCVRLFKEgwfeteiaegddpklskmkkdvvvggkdvkevdnDFFLVVVKILdhqgplsstfpienrtTQVTMRALKShlnrspslplvkrISDFHLLLFLARFLDLNSDVPALAQCVQAQTAVPEGYKLLINSMAETV

mllrirsrdglervtvdgahvtVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQFTDMANPDRPLSSLNISHGSIVFLSYDGERNVRgpsfnpagsfgrkMTMDDLIAKQMRVTRQENPHCESVSFDRDCADAFQQYVNETLAFAVKRGGFMYGTVLEDKRVEVNFiyeppqqgtEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQNKKDYTLSNREVLQAVEFHAECNMEEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETeiaegddpklskmKKDVVvggkdvkevdnDFFLVVVKILdhqgplsstfpienrtTQVTMRALKShlnrspslplVKRISDFHLLLFLARFLDLNSDVPALAQCVQAQTAVPEGYKLLINSMAETV

MLLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQFTDMANPDRPLSSLNISHGSIVFLSYDGERNVRGPSFNPAGSFGRKMTMDDLIAKQMRVTRQENPHCESVSFDRDCADAFQQYVNETLAFAVKRGGFMYGTVLEDKRVEVNFIYEPPQQGTEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQNKKDYTLSNREVLQAVEFHAECNMEEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIAEGDDPKLSkmkkdvvvggkdvkevdndFFLVVVKILDHQGPLSSTFPIENRTTQVTMRALKSHLNRSPSLPLVKRISDfhlllflarfldlNSDVPALAQCVQAQTAVPEGYKLLINSMAETV

**********LERVTVDGAHVTVAELKTIIQSQLRIPVE**********L***********************LNISHGSIVFLSYDG**************************************CESVSFDRDCADAFQQYVNETLAFAVKRGGFMYGTVLEDKRVEVNFIYEPPQQGTEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQNKKDYTLSNREVLQAVEFHAECNMEEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIAE**********KDVVVGGKDVKEVDNDFFLVVVKILDHQGPLSSTFPIENRTTQVTMRAL********SLPLVKRISDFHLLLFLARFLDLNSDVPALAQCVQAQTAVPEGYKLLI*******

MLLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIP**************************************IS*GSIV***********************KMTMDDLIAKQMRVTRQENPHCESVSFDRDCADAFQQYVNETLAFAVKRGGFMYGTVLEDKRVEVNFIYEPPQQGTEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQNKKDYTLSNREVLQAVEFHAECNMEEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIA********KMKKDVVVGGKDVKEVDNDFFLVVVKILDHQGPLSSTFPIENRTTQVTMRALKSHLNRSPSLPLVKRISDFHLLLFLARFLDLNSDVPALAQCVQAQTAVPEGYKLLINSMAETV

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		411	2.2.26 [Sep-21-2011]
Q9LYC2		413	NPL4-like protein 1 OS=Ar	yes	no	0.995	0.990	0.736	0.0
O82264		413	NPL4-like protein 2 OS=Ar	no	no	0.997	0.992	0.729	0.0
Q9AS33		415	NPL4-like protein OS=Oryz	yes	no	0.982	0.973	0.592	1e-134
Q54GD3		576	Nuclear protein localizat	yes	no	0.649	0.463	0.306	3e-31
Q8TAT6		608	Nuclear protein localizat	yes	no	0.596	0.402	0.293	3e-20
P60670		608	Nuclear protein localizat	yes	no	0.596	0.402	0.290	3e-20
Q9ES54		608	Nuclear protein localizat	yes	no	0.596	0.402	0.287	9e-20
Q9VBP9		652	Nuclear protein localizat	yes	no	0.673	0.424	0.25	5e-14
Q1DY54		657	Nuclear protein localizat	N/A	no	0.632	0.395	0.288	3e-10
A2Q8R9		654	Nuclear protein localizat	yes	no	0.613	0.385	0.285	7e-10

>sp\|Q9LYC2\|NPL41_ARATH NPL4-like protein 1 OS=Arabidopsis thaliana GN=At3g63000 PE=1 SV=1	Back alignment and function desciption

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/410 (73%), Positives = 362/410 (88%), Gaps = 1/410 (0%)

Query: 2   LLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQF 61
           +LR+RSRDGLERV+VDG H+TV++LKT+IQ QL+IP+ +QTLSTN+NLLLAKSPSD L F
Sbjct: 3   MLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAF 62

Query: 62  TDMANPDRPLSSLNISHGSIVFLSYDGERNVRG-PSFNPAGSFGRKMTMDDLIAKQMRVT 120
           TDMA+P+  +SSLN++HGS+V+L+Y+GER +RG P+  PAGSFGRKMT++DLIA+QMRV 
Sbjct: 63  TDMADPNLRISSLNLAHGSMVYLAYEGERTIRGGPAVTPAGSFGRKMTVEDLIARQMRVG 122

Query: 121 RQENPHCESVSFDRDCADAFQQYVNETLAFAVKRGGFMYGTVLEDKRVEVNFIYEPPQQG 180
           RQE  HC+SVSFDRDCA+AFQ +VNE+LAFAVKRGGFMYG V ED +VEVNFIYEPPQQG
Sbjct: 123 RQEKAHCDSVSFDRDCANAFQHFVNESLAFAVKRGGFMYGNVSEDGQVEVNFIYEPPQQG 182

Query: 181 TEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQNKKDYTLSNREVLQAVEFHAE 240
            E+ L ++RD EEEK VDAIA GLGM++VGFIF QT+ Q+KK+YTLSN EVL A + HAE
Sbjct: 183 MEDNLILMRDSEEEKRVDAIALGLGMRRVGFIFNQTVTQDKKEYTLSNVEVLLAAQLHAE 242

Query: 241 CNMEEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIAEGDDPKLSKMKK 300
             ++EWVTAVVKLE++E+G A +HFE FQMSDMCVRLFKEGWFETEI   DDPKLSK+KK
Sbjct: 243 SELKEWVTAVVKLEINEDGGADVHFEPFQMSDMCVRLFKEGWFETEIGPEDDPKLSKLKK 302

Query: 301 DVVVGGKDVKEVDNDFFLVVVKILDHQGPLSSTFPIENRTTQVTMRALKSHLNRSPSLPL 360
           +VVVG KDVKEVDNDFFLV+VKILDHQGPLS TFPIENR TQ TMRALK+H+ R+ SLP 
Sbjct: 303 EVVVGVKDVKEVDNDFFLVLVKILDHQGPLSCTFPIENRNTQTTMRALKTHMERARSLPF 362

Query: 361 VKRISDFHLLLFLARFLDLNSDVPALAQCVQAQTAVPEGYKLLINSMAET 410
           VKRISDFHLLLF+A+FLD++SDVPALA+CV+ Q+ VPEGY+LLI+SMA T
Sbjct: 363 VKRISDFHLLLFVAQFLDVSSDVPALAECVRLQSHVPEGYELLIDSMANT 412

May be part of a complex that binds ubiquitinated proteins and that is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome.
Arabidopsis thaliana (taxid: 3702)

>sp\|O82264\|NPL42_ARATH NPL4-like protein 2 OS=Arabidopsis thaliana GN=At2g47970 PE=1 SV=1	Back alignment and function description

>sp\|Q9AS33\|NPL4_ORYSJ NPL4-like protein OS=Oryza sativa subsp. japonica GN=Os01g0377700 PE=2 SV=1	Back alignment and function description

>sp\|Q54GD3\|NPL4_DICDI Nuclear protein localization protein 4 homolog OS=Dictyostelium discoideum GN=nploc4 PE=3 SV=1	Back alignment and function description

>sp\|Q8TAT6\|NPL4_HUMAN Nuclear protein localization protein 4 homolog OS=Homo sapiens GN=NPLOC4 PE=1 SV=3	Back alignment and function description

>sp\|P60670\|NPL4_MOUSE Nuclear protein localization protein 4 homolog OS=Mus musculus GN=Nploc4 PE=1 SV=3	Back alignment and function description

>sp\|Q9ES54\|NPL4_RAT Nuclear protein localization protein 4 homolog OS=Rattus norvegicus GN=Nploc4 PE=1 SV=3	Back alignment and function description

>sp\|Q9VBP9\|NPL4_DROME Nuclear protein localization protein 4 homolog OS=Drosophila melanogaster GN=CG4673 PE=1 SV=3	Back alignment and function description

>sp\|Q1DY54\|NPL4_COCIM Nuclear protein localization protein 4 OS=Coccidioides immitis (strain RS) GN=NPL4 PE=3 SV=1	Back alignment and function description

>sp\|A2Q8R9\|NPL4_ASPNC Nuclear protein localization protein 4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=npl4 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		411
224068755		411	predicted protein [Populus trichocarpa]	0.997	0.997	0.802	0.0
356505489		413	PREDICTED: NPL4-like protein 1-like [Gly	0.997	0.992	0.781	0.0
356572673		413	PREDICTED: NPL4-like protein 1-like [Gly	0.997	0.992	0.786	0.0
449456429		411	PREDICTED: NPL4-like protein 1-like [Cuc	0.992	0.992	0.764	0.0
449497385		411	PREDICTED: LOW QUALITY PROTEIN: NPL4-lik	0.992	0.992	0.764	0.0
225436827		411	PREDICTED: NPL4-like protein 2 [Vitis vi	0.992	0.992	0.75	0.0
358348088		414	NPL4-like protein [Medicago truncatula]	0.992	0.985	0.756	0.0
15229360		413	nuclear protein localization protein 4-l	0.995	0.990	0.736	0.0
18407495		413	NPL4-like protein 2 [Arabidopsis thalian	0.997	0.992	0.729	0.0
297817634		413	NPL4 family protein [Arabidopsis lyrata	0.995	0.990	0.731	0.0

>gi\|224068755\|ref\|XP_002302817.1\| predicted protein [Populus trichocarpa] gi\|118484264\|gb\|ABK94012.1\| unknown [Populus trichocarpa] gi\|222844543\|gb\|EEE82090.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/410 (80%), Positives = 378/410 (92%)

Query: 1   MLLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQ 60
           +++RIRSRDGLERV++D  ++TV++LKT+IQ+QL+IP+ SQTLSTNQ+LLLAKSPSDLL+
Sbjct: 2   VMVRIRSRDGLERVSIDNTNITVSQLKTLIQNQLQIPIRSQTLSTNQSLLLAKSPSDLLK 61

Query: 61  FTDMANPDRPLSSLNISHGSIVFLSYDGERNVRGPSFNPAGSFGRKMTMDDLIAKQMRVT 120
           FTDM+NPD PLSSL+ISHGS++FL+YDGER + GP+  PAGSFGRKMT+DDLIAKQMRVT
Sbjct: 62  FTDMSNPDTPLSSLSISHGSLIFLAYDGERTIAGPAVRPAGSFGRKMTIDDLIAKQMRVT 121

Query: 121 RQENPHCESVSFDRDCADAFQQYVNETLAFAVKRGGFMYGTVLEDKRVEVNFIYEPPQQG 180
           RQENPHC+SVSFDRDCA+AFQ YVNETLAFAVKRGGFMYGTV E+ +VEV+FIYEPPQQG
Sbjct: 122 RQENPHCDSVSFDRDCANAFQHYVNETLAFAVKRGGFMYGTVSEEGKVEVDFIYEPPQQG 181

Query: 181 TEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQNKKDYTLSNREVLQAVEFHAE 240
           TEEVL +LRD +EEKLV+AI A LGM++VGFIFTQTIMQ+KKDYTLS+REVLQA E HAE
Sbjct: 182 TEEVLMLLRDSDEEKLVEAITACLGMRRVGFIFTQTIMQDKKDYTLSHREVLQAAELHAE 241

Query: 241 CNMEEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIAEGDDPKLSKMKK 300
             ++EWVTAVVKLEVSE+G A +HFEAFQMSDMC+RLFKEGWFETEI E  DPKLSKMKK
Sbjct: 242 SELKEWVTAVVKLEVSEDGGADVHFEAFQMSDMCIRLFKEGWFETEIGEDADPKLSKMKK 301

Query: 301 DVVVGGKDVKEVDNDFFLVVVKILDHQGPLSSTFPIENRTTQVTMRALKSHLNRSPSLPL 360
           DVVVG KDVKEVDNDFFLVVVKILDH GPLSSTFPIENR TQVTMRAL+SHL+R+ +LP 
Sbjct: 302 DVVVGTKDVKEVDNDFFLVVVKILDHLGPLSSTFPIENRITQVTMRALRSHLDRAKNLPF 361

Query: 361 VKRISDFHLLLFLARFLDLNSDVPALAQCVQAQTAVPEGYKLLINSMAET 410
           VKRISDFHLLLFLA++LDLNSDVPALA+CV AQTAVPEGY++LI SMA T
Sbjct: 362 VKRISDFHLLLFLAKYLDLNSDVPALAECVLAQTAVPEGYQILIESMATT 411

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356505489\|ref\|XP_003521523.1\| PREDICTED: NPL4-like protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|356572673\|ref\|XP_003554491.1\| PREDICTED: NPL4-like protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|449456429\|ref\|XP_004145952.1\| PREDICTED: NPL4-like protein 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449497385\|ref\|XP_004160387.1\| PREDICTED: LOW QUALITY PROTEIN: NPL4-like protein 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|225436827\|ref\|XP_002270748.1\| PREDICTED: NPL4-like protein 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|358348088\|ref\|XP_003638081.1\| NPL4-like protein [Medicago truncatula] gi\|355504016\|gb\|AES85219.1\| NPL4-like protein [Medicago truncatula]	Back alignment and taxonomy information

>gi|15229360|ref|NP_191859.1| nuclear protein localization protein 4-like protein [Arabidopsis thaliana] gi|75181052|sp|Q9LYC2.1|NPL41_ARATH RecName: Full=NPL4-like protein 1 gi|7573429|emb|CAB87745.1| putative protein [Arabidopsis thaliana] gi|14334782|gb|AAK59569.1| unknown protein [Arabidopsis thaliana] gi|15810647|gb|AAL07248.1| unknown protein [Arabidopsis thaliana] gi|110735118|gb|ABG89129.1| NPL4a [synthetic construct] gi|332646901|gb|AEE80422.1| nuclear protein localization protein 4-like protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi|18407495|ref|NP_566118.1| NPL4-like protein 2 [Arabidopsis thaliana] gi|75100586|sp|O82264.1|NPL42_ARATH RecName: Full=NPL4-like protein 2 gi|3738309|gb|AAC63651.1| expressed protein [Arabidopsis thaliana] gi|20197558|gb|AAM15128.1| expressed protein [Arabidopsis thaliana] gi|110735120|gb|ABG89130.1| NPL4b [synthetic construct] gi|330255825|gb|AEC10919.1| NPL4-like protein 2 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297817634\|ref\|XP_002876700.1\| NPL4 family protein [Arabidopsis lyrata subsp. lyrata] gi\|297322538\|gb\|EFH52959.1\| NPL4 family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		411
TAIR\|locus:2099142		413	NPL41 "AT3G63000" [Arabidopsis	0.995	0.990	0.673	6.4e-147
TAIR\|locus:2043443		413	AT2G47970 "AT2G47970" [Arabido	0.997	0.992	0.666	9.3e-146
DICTYBASE\|DDB_G0290227		576	npl4 "nuclear protein localiza	0.669	0.477	0.286	4.1e-21
UNIPROTKB\|Q7SZT9		610	nploc4 "Npl4 protein" [Xenopus	0.253	0.170	0.373	2.3e-13
UNIPROTKB\|F1N7U2		608	NPLOC4 "Uncharacterized protei	0.279	0.189	0.357	2e-11
UNIPROTKB\|F1PNX1		608	NPLOC4 "Uncharacterized protei	0.279	0.189	0.357	2e-11
UNIPROTKB\|Q8TAT6		608	NPLOC4 "Nuclear protein locali	0.279	0.189	0.357	6.5e-11
MGI\|MGI:2679787		608	Nploc4 "nuclear protein locali	0.279	0.189	0.357	1.3e-10
RGD\|620794		608	Nploc4 "nuclear protein locali	0.279	0.189	0.350	2.9e-10
UNIPROTKB\|Q9ES54		608	Nploc4 "Nuclear protein locali	0.279	0.189	0.350	2.9e-10

TAIR\|locus:2099142 NPL41 "AT3G63000" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1435 (510.2 bits), Expect = 6.4e-147, P = 6.4e-147
 Identities = 276/410 (67%), Positives = 331/410 (80%)

Query:     2 LLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQF 61
             +LR+RSRDGLERV+VDG H+TV++LKT+IQ QL+IP+ +QTLSTN+NLLLAKSPSD L F
Sbjct:     3 MLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAF 62

Query:    62 TDMANPDRPLSSLNISHGSIVFLSYDGERNVRG-PSFNPAGSFGRKMTMDDLIAKQMRVT 120
             TDMA+P+  +SSLN++HGS+V+L+Y+GER +RG P+  PAGSFGRKMT++DLIA+QMRV 
Sbjct:    63 TDMADPNLRISSLNLAHGSMVYLAYEGERTIRGGPAVTPAGSFGRKMTVEDLIARQMRVG 122

Query:   121 RQENPHCESVSFDRDCADAFQQYVNETLAFAVKRGGFMYGTVLEDKRVEVNFIYEPPQQG 180
             RQE  HC+SVSFDRDCA+AFQ +VNE+LAFAVKRGGFMYG V ED +VEVNFIYEPPQQG
Sbjct:   123 RQEKAHCDSVSFDRDCANAFQHFVNESLAFAVKRGGFMYGNVSEDGQVEVNFIYEPPQQG 182

Query:   181 TEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQNKKDYTLSNREVLQAVEFHAE 240
              E+ L ++RD EEEK VDAIA GLGM++VGFIF QT+ Q+KK+YTLSN EVL A + HAE
Sbjct:   183 MEDNLILMRDSEEEKRVDAIALGLGMRRVGFIFNQTVTQDKKEYTLSNVEVLLAAQLHAE 242

Query:   241 CNMEEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIAEGDDPKLSXXXX 300
               ++EWVTAVVKLE++E+G A +HFE FQMSDMCVRLFKEGWFETEI   DDPKLS    
Sbjct:   243 SELKEWVTAVVKLEINEDGGADVHFEPFQMSDMCVRLFKEGWFETEIGPEDDPKLSKLKK 302

Query:   301 XXXXXXXXXXXXXXXFFLVVVKILDHQGPLSSTFPIENRTTQVTMRALKSHLNRSPSLPL 360
                            FFLV+VKILDHQGPLS TFPIENR TQ TMRALK+H+ R+ SLP 
Sbjct:   303 EVVVGVKDVKEVDNDFFLVLVKILDHQGPLSCTFPIENRNTQTTMRALKTHMERARSLPF 362

Query:   361 VKRISDXXXXXXXXXXXXXNSDVPALAQCVQAQTAVPEGYKLLINSMAET 410
             VKRISD             +SDVPALA+CV+ Q+ VPEGY+LLI+SMA T
Sbjct:   363 VKRISDFHLLLFVAQFLDVSSDVPALAECVRLQSHVPEGYELLIDSMANT 412

GO:0003674 "molecular_function" evidence=ND

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0005829 "cytosol" evidence=IDA

TAIR\|locus:2043443 AT2G47970 "AT2G47970" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0290227 npl4 "nuclear protein localization 4" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7SZT9 nploc4 "Npl4 protein" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N7U2 NPLOC4 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PNX1 NPLOC4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8TAT6 NPLOC4 "Nuclear protein localization protein 4 homolog" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:2679787 Nploc4 "nuclear protein localization 4 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|620794 Nploc4 "nuclear protein localization 4 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9ES54 Nploc4 "Nuclear protein localization protein 4 homolog" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9LYC2	NPL41_ARATH	No assigned EC number	0.7365	0.9951	0.9903	yes	no
O82264	NPL42_ARATH	No assigned EC number	0.7299	0.9975	0.9927	no	no
Q9AS33	NPL4_ORYSJ	No assigned EC number	0.5923	0.9829	0.9734	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00001956	SubName- Full=Putative uncharacterized protein; (411 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	gw1.258.14.1	hypothetical protein (408 aa)	•	0.800
	fgenesh4_pg.C_LG_XIII000461	hypothetical protein (439 aa)	•	0.800
	eugene3.00160841	hypothetical protein (803 aa)	•	0.800
	eugene3.00120808	hypothetical protein (800 aa)	•	0.800
	estExt_fgenesh4_pm.C_280088	hypothetical protein (810 aa)	•	0.800
	estExt_fgenesh4_pg.C_LG_XV0552	hypothetical protein (814 aa)	•	0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		411
pfam05021		306	pfam05021, NPL4, NPL4 family	1e-77
cd08061		274	cd08061, MPN_NPL4, Mov34/MPN/PAD-1 family: nuclear	7e-74
COG5100		571	COG5100, NPL4, Nuclear pore protein [Nuclear struc	7e-08
pfam11543		80	pfam11543, UN_NPL4, Nuclear pore localisation prot	7e-04

>gnl\|CDD\|218386 pfam05021, NPL4, NPL4 family	Back alignment and domain information

 Score =  242 bits (619), Expect = 1e-77
 Identities = 95/311 (30%), Positives = 145/311 (46%), Gaps = 61/311 (19%)

Query: 154 RGGFMYGTVLEDK------RVEVNFIYEPPQQGTEEVLYILRDEEEEKLVDAIAAGLGMK 207
           R GF+YG   ED       +  V  IYEPPQ+G E+ +  L  +EEEK VDAIA+ LG++
Sbjct: 1   RFGFLYGRYEEDDKVPLGIKAVVEAIYEPPQEGEEDGV-TLLPDEEEKDVDAIASSLGLE 59

Query: 208 KVGFIFTQTIM-----------QNKKDYTLSNREVLQAVEFHAE-------CNMEEWVTA 249
           +VG+IFT               ++K  Y LS+ EV+ A     +            + + 
Sbjct: 60  RVGWIFTDLTDAGAGDGTVLCKRHKDSYFLSSLEVIMAARLQLKHPNPTKYSETGYFGSK 119

Query: 250 VVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIAEGDDPKLSKMKK--------D 301
            V   +S + +  I  EA+Q+SD  + L +    E       DP +  +++        D
Sbjct: 120 FVTCVISGDLNGEISIEAYQVSDQAMALVRADIIEPST----DPSVIYVREPNKNRYVPD 175

Query: 302 VVVG-----GKDVKE----VDNDFFLVVVKILDHQGPL----SSTFPIENRTT---QVTM 345
           V        GK+VKE       ++ LV +     + P     SSTFPIENR        +
Sbjct: 176 VFYRKINEYGKEVKENAKPFPVEYLLVTLTHGFPEDPSPLFKSSTFPIENREAMGESQDL 235

Query: 346 RALKSHLNRSPSLPLVKRISDFHLLLFLARFLDLN-SDVPALAQCVQ-------AQTAVP 397
           RAL  +L      P ++R+SDFHLLLFLA+   L+ S+   L + V+        Q +  
Sbjct: 236 RALAKYLKSHKPKPFLERLSDFHLLLFLAKLGILDISEAKLLCEAVRTKDEEDALQLSKS 295

Query: 398 EGYKLLINSMA 408
           EG++ L++ + 
Sbjct: 296 EGWQTLLDILE 306

The HRD4 gene was identical to NPL4, a gene previously implicated in nuclear transport. Using a diverse set of substrates and direct ubiquitination assays, analysis revealed that HRD4/NPL4 is required for a poorly characterized step in ER-associated degradation after ubiquitination of target proteins but before their recognition by the 26S proteasome. Npl4p physically associates with Cdc48p via Ufd1p to form a Cdc48p-Ufd1p-Npl4p complex. The Cdc48-Ufd1-Npl4 complex functions in the recognition of several polyubiquitin-tagged proteins and facilitates their presentation to the 26S proteasome for processive degradation or even more specific processing. Length = 306

>gnl\|CDD\|163692 cd08061, MPN_NPL4, Mov34/MPN/PAD-1 family: nuclear protein localization-4 (Npl4) domain	Back alignment and domain information

>gnl\|CDD\|227431 COG5100, NPL4, Nuclear pore protein [Nuclear structure]	Back alignment and domain information

>gnl\|CDD\|221132 pfam11543, UN_NPL4, Nuclear pore localisation protein NPL4	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		411
KOG2834		510	consensus Nuclear pore complex, rNpl4 component (s	100.0
COG5100		571	NPL4 Nuclear pore protein [Nuclear structure]	100.0
cd08061		274	MPN_NPL4 Mov34/MPN/PAD-1 family: nuclear protein l	100.0
PF05021		306	NPL4: NPL4 family; InterPro: IPR007717 The HRD4 ge	100.0
cd08056		252	MPN_PRP8 Mpr1p, Pad1p N-terminal (MPN) domains wit	99.85
PF11543		80	UN_NPL4: Nuclear pore localisation protein NPL4; I	99.85
cd08066		173	MPN_AMSH_like Mov34/MPN/PAD-1 family. AMSH (associ	98.74
PF05020		147	zf-NPL4: NPL4 family, putative zinc binding region	98.66
cd07767		116	MPN Mpr1p, Pad1p N-terminal (MPN) domains. MPN (al	98.64
smart00232		135	JAB_MPN JAB/MPN domain. Domain in Jun kinase activ	98.46
cd01799		75	Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO	98.37
cd08067		187	MPN_2A_DUB Mov34/MPN/PAD-1 family: Histone H2A deu	98.25
cd01791		73	Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know	98.17
cd01809		72	Scythe_N Ubiquitin-like domain of Scythe protein.	98.1
smart00213		64	UBQ Ubiquitin homologues. Ubiquitin-mediated prote	98.07
cd01806		76	Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn	98.01
cd01812		71	BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter	97.91
cd01796		71	DDI1_N DNA damage inducible protein 1 ubiquitin-li	97.88
cd01807		74	GDX_N ubiquitin-like domain of GDX. GDX contains a	97.86
cd01803		76	Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40	97.85
cd01805		77	RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo	97.83
PF00240		69	ubiquitin: Ubiquitin family; InterPro: IPR000626 U	97.8
cd01795		107	USP48_C USP ubiquitin-specific protease. The USP (	97.79
cd01797		78	NIRF_N amino-terminal ubiquitin-like domain of Np9	97.74
cd01808		71	hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC	97.73
cd01763		87	Sumo Small ubiquitin-related modifier (SUMO). Smal	97.72
cd01810		74	ISG15_repeat2 ISG15 ubiquitin-like protein, second	97.69
PF01398		114	JAB: JAB1/Mov34/MPN/PAD-1 ubiquitin protease; Inte	97.66
cd01793		74	Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui	97.59
cd01804		78	midnolin_N Ubiquitin-like domain of midnolin. midn	97.59
PF11976		72	Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter	97.58
PTZ00044		76	ubiquitin; Provisional	97.55
cd01794		70	DC_UbP_C dendritic cell derived ubiquitin-like pro	97.49
cd08069		268	MPN_RPN11_CSN5 Mov34/MPN/PAD-1 family: proteasomal	97.47
cd01792		80	ISG15_repeat1 ISG15 ubiquitin-like protein, first	97.45
cd01802		103	AN1_N ubiquitin-like domain of AN1. AN1 (also know	97.4
cd08068		244	MPN_BRCC36 Mov34/MPN/PAD-1 family: BRCC36, a subun	97.4
cd01798		70	parkin_N amino-terminal ubiquitin-like of parkin p	97.38
cd01813		74	UBP_N UBP ubiquitin processing protease. The UBP (	97.32
PF14560		87	Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K	97.24
cd01800		76	SF3a120_C Ubiquitin-like domain of Mammalian splic	97.18
cd08065		266	MPN_eIF3h Mpr1p, Pad1p N-terminal (MPN) domains wi	97.05
cd01769		69	UBL Ubiquitin-like domain of UBL. UBLs function by	97.02
PF00789		82	UBX: UBX domain; InterPro: IPR001012 The UBX domai	96.75
cd08058		119	MPN_euk_mb Mpr1p, Pad1p N-terminal (MPN) domains w	96.62
cd01789		84	Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol	96.54
cd01790		79	Herp_N Homocysteine-responsive endoplasmic reticul	96.33
TIGR00601		378	rad23 UV excision repair protein Rad23. All protei	96.31
PLN02560		308	enoyl-CoA reductase	96.17
smart00166		80	UBX Domain present in ubiquitin-regulatory protein	96.17
cd01801		77	Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N-	95.77
cd01771		80	Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac	95.6
cd08070		128	MPN_like Mpr1p, Pad1p N-terminal (MPN) domains wit	95.54
cd01767		77	UBX UBX (ubiquitin regulatory X) domain. The UBX (	95.52
cd01773		82	Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i	95.48
KOG2834		510	consensus Nuclear pore complex, rNpl4 component (s	95.43
cd01774		85	Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i	95.17
cd01770		79	p47_UBX p47-like ubiquitin domain. p47_UBX p47 is	95.16
KOG0010		493	consensus Ubiquitin-like protein [Posttranslationa	95.02
cd01772		79	SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst	94.88
KOG1795		2321	consensus U5 snRNP spliceosome subunit [RNA proces	94.84
cd01815		75	BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC	94.34
cd00196		69	UBQ Ubiquitin-like proteins. Ubiquitin homologs; I	93.93
cd01788		119	ElonginB Ubiquitin-like domain of Elongin B. Elong	93.83
KOG2880		424	consensus SMAD6 interacting protein AMSH, contains	93.1
COG5178		2365	PRP8 U5 snRNP spliceosome subunit [RNA processing	92.44
PF08817		79	YukD: WXG100 protein secretion system (Wss), prote	91.97
KOG0005		70	consensus Ubiquitin-like protein [Cell cycle contr	91.74
cd06409		86	PB1_MUG70 The MUG70 protein is a product of the me	90.82
KOG4495		110	consensus RNA polymerase II transcription elongati	90.34
PF11470		65	TUG-UBL1: GLUT4 regulating protein TUG; InterPro:	90.31
KOG0003		128	consensus Ubiquitin/60s ribosomal protein L40 fusi	89.93
cd01814		113	NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT	88.33
PF14732		87	UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquiti	86.98
PF08825		84	E2_bind: E2 binding domain; InterPro: IPR014929 E1	85.69
cd05992		81	PB1 The PB1 domain is a modular domain mediating s	84.94
PF14836		88	Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A	84.24
cd06406		80	PB1_P67 A PB1 domain is present in p67 proteins wh	83.73
cd06407		82	PB1_NLP A PB1 domain is present in NIN like protei	83.06
KOG0004		156	consensus Ubiquitin/40S ribosomal protein S27a fus	83.06
cd08060		182	MPN_UPF0172 Mov34/MPN/PAD-1 family: UPF0172 family	82.77
PF11039		151	DUF2824: Protein of unknown function (DUF2824); In	82.05

>KOG2834 consensus Nuclear pore complex, rNpl4 component (sc Npl4) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Probab=100.00  E-value=1.7e-84  Score=648.97  Aligned_cols=388  Identities=36%  Similarity=0.503  Sum_probs=322.4

Q ss_pred             EEEcCCCceEEEecCCCCcHHHHHHHHHhhcCCCCCCceeeccccccccCCCCcccccccCCCCCCCccccccccccEEE
Q 015194            4 RIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQFTDMANPDRPLSSLNISHGSIVF   83 (411)
Q Consensus         4 RvRS~~G~~Rv~v~~p~~t~~~L~~kI~~~l~~~~~~~~Ls~~~~~~~~~~p~~~~~~~~l~~~~~tl~~lGLkHGDml~   83 (411)
                      |+|++++-.|++.+++.-+-+...-.+...++.+...+.|.-....+.++++-  +-++..+..++.+++++..||   |
T Consensus        56 ~vr~~dvde~ls~edg~I~rsk~~lcrh~~~~mc~~c~pL~p~de~yl~~n~i--kh~Sfhay~rkl~s~~nk~~~---~  130 (510)
T KOG2834|consen   56 RVRSRDVDERLSKEDGLITRSKDKLCRHDPLQMCTHCSPLDPFDEEYLKKNKI--KHLSFHAYLRKLLSSLNKGHG---Y  130 (510)
T ss_pred             ceecccccchhhhcCCceeeccCcccccCccccCCcCCCCCcchHHHhhcCcc--eeeechhhHhhhhccccccCc---c
Confidence            78999999999988534455555545555566666667775555555444431  112333345788899999999   9


Q ss_pred             EeecCccccCCCCCCCCCCCCcccchhHHHHhhccccCccCCCcceEEEech-hhhhHHHHHHHHhhccceeeeeeeeee
Q 015194           84 LSYDGERNVRGPSFNPAGSFGRKMTMDDLIAKQMRVTRQENPHCESVSFDRD-CADAFQQYVNETLAFAVKRGGFMYGTV  162 (411)
Q Consensus        84 l~y~~~~~~~~~~~~~~~~~gk~~~~dd~~~k~~~i~rq~~~~~d~vsf~~~-~~~~fq~~~~~~l~~~~QR~G~LYG~Y  162 (411)
                      +.|.++........|..++.+.++...+..+++++|+||++||||||+|++. .+++|.++||.+   |.||+|||||+|
T Consensus       131 ~~~l~e~s~~~~~~c~~h~p~p~gictkcqp~~i~L~rQ~frhvD~VeFd~~~~v~~Fl~~wr~s---g~QR~GflyG~y  207 (510)
T KOG2834|consen  131 IAPLEEPSCRGKPNCEAHSPGPKGICTKCQPSQITLNRQEFRHVDHVEFDNAELVNHFLNEWRAS---GVQRFGFLYGRY  207 (510)
T ss_pred             cccccCcccccCCCCcCCCCCCCceecccchhheEeccccceecceEeecchHHHHHHHHHHHHh---hhhhcceEEEee
Confidence            9998887777667787788899999999999999999999999999999975 468888888766   999999999999


Q ss_pred             ecCC------cEEEEeEeCCCCCCCcCceEEcCCchhHHHHHHHHHhcCCeEEEEEEeecccC-----------CCCcee
Q 015194          163 LEDK------RVEVNFIYEPPQQGTEEVLYILRDEEEEKLVDAIAAGLGMKKVGFIFTQTIMQ-----------NKKDYT  225 (411)
Q Consensus       163 ~~~~------~a~VeAIYEPPQ~~~~dg~~l~~d~~~e~~vd~iA~~lGL~~VG~IfTdl~~~-----------~~~~~f  225 (411)
                      .+|.      ||+|+|||||||+|++||++|+++. ++++||++|..|||+||||||||++++           ++++||
T Consensus       208 ~e~~~vPLGika~V~aIYEPPQ~~~~dgl~l~~~~-e~~~vD~~a~~lGLrRVG~IFTDl~~~~s~egtV~~~rhkdsyF  286 (510)
T KOG2834|consen  208 TEHGNVPLGIKAVVAAIYEPPQHGEEDGLELLEDD-EAKRVDAIAEGLGLRRVGWIFTDLVTADSAEGTVHYKRHKDSYF  286 (510)
T ss_pred             cccccccccceeeEEEEecCCccCCcCCeEEeccc-hhhhHHHHHHhcCceeeEEEEeeeecccCccceEEeeeccchhc
Confidence            9986      7799999999999999999999554 457899999999999999999999855           478999


Q ss_pred             ecHHHHHHHHHHHHhcCC-----------CceEEEEEEeeecCCCCcceeEEEeeccHHHHHHhhcCcccccccCCCCcc
Q 015194          226 LSNREVLQAVEFHAECNM-----------EEWVTAVVKLEVSEEGSAAIHFEAFQMSDMCVRLFKEGWFETEIAEGDDPK  294 (411)
Q Consensus       226 LSs~Eii~aa~~Q~~~~~-----------skfvT~vvt~~~~~d~~~~I~~eayQvS~q~~aLv~~~~i~~s~~~~~~p~  294 (411)
                      |||+||++||+||++||+           |||||+|||    +|.+|+|||++|||||||||||+||+|+|+    .+|+
T Consensus       287 LSseE~~~aa~~Q~~hpn~~~~s~~~~fgSkfVT~vis----g~~~~~V~f~~YQVSnqc~alv~adl~~p~----~~pk  358 (510)
T KOG2834|consen  287 LSSEECITAAMFQNKHPNICEWSRDGHFGSKFVTLVIS----GDLDGEVHFEGYQVSNQCMALVEADLLCPS----LDPK  358 (510)
T ss_pred             ccHHHHHHHhhhhhcCCchheeeccccccceeEEEEEe----cCCCcceeeeeeehhHHHHHHhhhhhccCC----cCcc
Confidence            999999999999999995           799999999    456699999999999999999999999996    3588


Q ss_pred             cccccc--------ceEEc---------cccccccCCceeEEEEeec---cCCCCCcc--CCCCCCCCC---cccHHHHH
Q 015194          295 LSKMKK--------DVVVG---------GKDVKEVDNDFFLVVVKIL---DHQGPLSS--TFPIENRTT---QVTMRALK  349 (411)
Q Consensus       295 ~~~~~~--------~V~~~---------~k~~~~vd~~~llv~v~~~---~h~~p~~~--~FPieNR~~---~q~~~~l~  349 (411)
                      .+|+++        +|+|.         .|.++|+|++||||.|++.   +|-.+.++  +||||||+.   .|....|+
T Consensus       359 ~~yv~~t~~~r~v~dv~~~~~~kyg~ev~k~akPlPveflLV~vt~gp~~p~~~F~s~t~~fpienR~~~g~~q~~~~l~  438 (510)
T KOG2834|consen  359 LGYVKETPDPRYVPDVQYSKKNKYGAEVMKNAKPLPVEFLLVDVTHGPKEPHYTFSSSTAPFPIENRQAIGQTQGLASLA  438 (510)
T ss_pred             cceeccCCChhcccchHHHhhhHHHHHHHhcCccCCceEEEEEeccCCCCCCcccccccCCCccccHHHHHHhhhHHHHH
Confidence            877654        45443         3455678999999999443   22222233  599999985   68899999


Q ss_pred             HhhccCCCccccccccchhHHHHHhhCCCcC-ccHHHHHHHHHcCCCCchhHHHHHHHhh
Q 015194          350 SHLNRSPSLPLVKRISDFHLLLFLARFLDLN-SDVPALAQCVQAQTAVPEGYKLLINSMA  408 (411)
Q Consensus       350 ~~l~~~~~~~~~~~~sDFHlLl~L~~~~~l~-~d~~~L~~~v~~~~~~~~~~~~li~s~~  408 (411)
                      +|+....+..+++++||||||||+++..+++ +++..|+++++.+.+.+++|+.+|+|.+
T Consensus       439 ~y~~~~~~~~~~~~~SnFhlLL~~~~~~~~~~d~vs~l~e~~~~~s~~ee~~~~~~es~~  498 (510)
T KOG2834|consen  439 KYSSELPSNQFLGKISNFHLLLFLATNLDVSSDEVSALLEFVRKQSDVEEGYELLIESEA  498 (510)
T ss_pred             HHhhccchhhhhhhhhhHHHHHhhHhhccCChHHHHHHHHHHHhccchHHHHHHHHHhhh
Confidence            9999887778999999999999999999999 7999999999999999999999999976

>COG5100 NPL4 Nuclear pore protein [Nuclear structure]	Back alignment and domain information

>cd08061 MPN_NPL4 Mov34/MPN/PAD-1 family: nuclear protein localization-4 (Npl4) domain	Back alignment and domain information

>PF05021 NPL4: NPL4 family; InterPro: IPR007717 The HRD4 gene is identical to NPL4, a gene previously implicated in nuclear transport	Back alignment and domain information

>cd08056 MPN_PRP8 Mpr1p, Pad1p N-terminal (MPN) domains without isopeptidase activity found in splicing factor Prp8	Back alignment and domain information

>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway	Back alignment and domain information

>cd08066 MPN_AMSH_like Mov34/MPN/PAD-1 family	Back alignment and domain information

>PF05020 zf-NPL4: NPL4 family, putative zinc binding region; InterPro: IPR007716 The HRD4 gene is identical to NPL4, a gene previously implicated in nuclear transport	Back alignment and domain information

>cd07767 MPN Mpr1p, Pad1p N-terminal (MPN) domains	Back alignment and domain information

>smart00232 JAB_MPN JAB/MPN domain	Back alignment and domain information

>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1	Back alignment and domain information

>cd08067 MPN_2A_DUB Mov34/MPN/PAD-1 family: Histone H2A deubiquitinase	Back alignment and domain information

>cd01791 Ubl5 UBL5 ubiquitin-like modifier	Back alignment and domain information

>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein	Back alignment and domain information

>smart00213 UBQ Ubiquitin homologues	Back alignment and domain information

>cd01806 Nedd8 Nebb8-like ubiquitin protein	Back alignment and domain information

>cd01812 BAG1_N Ubiquitin-like domain of BAG1	Back alignment and domain information

>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain	Back alignment and domain information

>cd01807 GDX_N ubiquitin-like domain of GDX	Back alignment and domain information

>cd01803 Ubiquitin Ubiquitin	Back alignment and domain information

>cd01805 RAD23_N Ubiquitin-like domain of RAD23	Back alignment and domain information

>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade	Back alignment and domain information

>cd01795 USP48_C USP ubiquitin-specific protease	Back alignment and domain information

>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF	Back alignment and domain information

>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2	Back alignment and domain information

>cd01763 Sumo Small ubiquitin-related modifier (SUMO)	Back alignment and domain information

>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2	Back alignment and domain information

>PF01398 JAB: JAB1/Mov34/MPN/PAD-1 ubiquitin protease; InterPro: IPR000555 Members of this family are found in proteasome regulatory subunits, eukaryotic initiation factor 3 (eIF3) subunits and regulators of transcription factors	Back alignment and domain information

>cd01793 Fubi Fubi ubiquitin-like protein	Back alignment and domain information

>cd01804 midnolin_N Ubiquitin-like domain of midnolin	Back alignment and domain information

>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins	Back alignment and domain information

>PTZ00044 ubiquitin; Provisional	Back alignment and domain information

>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein	Back alignment and domain information

>cd08069 MPN_RPN11_CSN5 Mov34/MPN/PAD-1 family: proteasomal regulatory protein Rpn11 and signalosome complex subunit CSN5	Back alignment and domain information

>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2	Back alignment and domain information

>cd01802 AN1_N ubiquitin-like domain of AN1	Back alignment and domain information

>cd08068 MPN_BRCC36 Mov34/MPN/PAD-1 family: BRCC36, a subunit of BRCA1-A complex	Back alignment and domain information

>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein	Back alignment and domain information

>cd01813 UBP_N UBP ubiquitin processing protease	Back alignment and domain information

>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A	Back alignment and domain information

>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120	Back alignment and domain information

>cd08065 MPN_eIF3h Mpr1p, Pad1p N-terminal (MPN) domains without catalytic isopeptidase activity, found in eIF2h	Back alignment and domain information

>cd01769 UBL Ubiquitin-like domain of UBL	Back alignment and domain information

>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast	Back alignment and domain information

>cd08058 MPN_euk_mb Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding); eukaryotic	Back alignment and domain information

>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B	Back alignment and domain information

>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein	Back alignment and domain information

>TIGR00601 rad23 UV excision repair protein Rad23	Back alignment and domain information

>PLN02560 enoyl-CoA reductase	Back alignment and domain information

>smart00166 UBX Domain present in ubiquitin-regulatory proteins	Back alignment and domain information

>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13	Back alignment and domain information

>cd01771 Faf1_UBX Faf1 UBX domain	Back alignment and domain information

>cd08070 MPN_like Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding)	Back alignment and domain information

>cd01767 UBX UBX (ubiquitin regulatory X) domain	Back alignment and domain information

>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain	Back alignment and domain information

>KOG2834 consensus Nuclear pore complex, rNpl4 component (sc Npl4) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain	Back alignment and domain information

>cd01770 p47_UBX p47-like ubiquitin domain	Back alignment and domain information

>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only]	Back alignment and domain information

>cd01772 SAKS1_UBX SAKS1-like UBX domain	Back alignment and domain information

>KOG1795 consensus U5 snRNP spliceosome subunit [RNA processing and modification]	Back alignment and domain information

>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP	Back alignment and domain information

>cd00196 UBQ Ubiquitin-like proteins	Back alignment and domain information

>cd01788 ElonginB Ubiquitin-like domain of Elongin B	Back alignment and domain information

>KOG2880 consensus SMAD6 interacting protein AMSH, contains JAB/MPN/Mov34 domain [Signal transduction mechanisms]	Back alignment and domain information

>COG5178 PRP8 U5 snRNP spliceosome subunit [RNA processing and modification]	Back alignment and domain information

>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold []	Back alignment and domain information

>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain	Back alignment and domain information

>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription]	Back alignment and domain information

>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly	Back alignment and domain information

>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4	Back alignment and domain information

>PF14732 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquitin-like domain; PDB: 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B	Back alignment and domain information

>PF08825 E2_bind: E2 binding domain; InterPro: IPR014929 E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades	Back alignment and domain information

>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity	Back alignment and domain information

>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A	Back alignment and domain information

>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis	Back alignment and domain information

>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium)	Back alignment and domain information

>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd08060 MPN_UPF0172 Mov34/MPN/PAD-1 family: UPF0172 family of unknown function includes neighbor of COX4 (Noc4p)	Back alignment and domain information

>PF11039 DUF2824: Protein of unknown function (DUF2824); InterPro: IPR022568 This family of proteins has no known function	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		411
1wf9_A		107	Solution Structure Of A Novel Beta-Grasp Fold Like		8e-35

>pdb|1WF9|A Chain A, Solution Structure Of A Novel Beta-Grasp Fold Like Domain Of Hypothetical Protein (Arabidopsis Thaliana) Length = 107

Back alignment and structure

Iteration: 1

Score = 144 bits (363), Expect = 8e-35, Method: Compositional matrix adjust. Identities = 64/93 (68%), Positives = 85/93 (91%) Query: 2 LLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQF 61 +LR+RSRDGLERV+VDG H+TV++LKT+IQ QL+IP+ +QTLSTN+NLLLAKSPSD L F Sbjct: 9 MLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAF 68 Query: 62 TDMANPDRPLSSLNISHGSIVFLSYDGERNVRG 94 TDMA+P+ +SSLN++HGS+V+L+Y+GER +RG Sbjct: 69 TDMADPNLRISSLNLAHGSMVYLAYEGERTIRG 101

PyMOL of 1wf9

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		411
1wf9_A		107	NPL4 family protein; beta-grAsp fold like domain,	2e-39
2pjh_A		80	Protein NPL4, nuclear protein localization protein	4e-11
2kzr_A		86	Ubiquitin thioesterase OTU1; structural genomics,	2e-08
1v5o_A		102	1700011N24RIK protein; hypothetical protein, ubiqu	9e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-04

>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 107	Back alignment and structure

 Score =  135 bits (341), Expect = 2e-39
 Identities = 64/95 (67%), Positives = 85/95 (89%)

Query: 1   MLLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQ 60
            +LR+RSRDGLERV+VDG H+TV++LKT+IQ QL+IP+ +QTLSTN+NLLLAKSPSD L 
Sbjct: 8   TMLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLA 67

Query: 61  FTDMANPDRPLSSLNISHGSIVFLSYDGERNVRGP 95
           FTDMA+P+  +SSLN++HGS+V+L+Y+GER +RG 
Sbjct: 68  FTDMADPNLRISSLNLAHGSMVYLAYEGERTIRGS 102

PyMOL of 1wf9

>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Length = 80	Back alignment and structure

>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Length = 86	Back alignment and structure

>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		411
2pjh_A		80	Protein NPL4, nuclear protein localization protein	99.72
1wf9_A		107	NPL4 family protein; beta-grAsp fold like domain,	99.55
2kzr_A		86	Ubiquitin thioesterase OTU1; structural genomics,	99.13
3rzv_A		211	STAM-binding protein; ubiquitin hydrolase, endosom	98.9
2znr_A		178	AMSH-like protease; metal binding protein, alterna	98.85
2p8r_A		273	PRP8, PRE-mRNA-splicing factor PRP8; alpha-beta, t	98.82
2og4_A		254	PRE-mRNA-splicing factor 8; isopeptidase, JAB1/MPN	98.8
3sbg_A		565	PRE-mRNA-splicing factor 8; PRP8P, rnaseh domain,	98.71
1ndd_A		76	NEDD8, protein (ubiquitin-like protein NEDD8); pro	98.5
3a9j_A		76	Ubiquitin; protein complex, cytoplasm, isopeptide	98.46
1yx5_B		98	Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s	98.38
3phx_B		79	Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu	98.36
2bwf_A		77	Ubiquitin-like protein DSK2; signaling protein, UB	98.34
2faz_A		78	Ubiquitin-like containing PHD and ring finger DOM	98.34
1wy8_A		89	NP95-like ring finger protein, isoform A; ubiquiti	98.33
1v5o_A		102	1700011N24RIK protein; hypothetical protein, ubiqu	98.33
2dzi_A		81	Ubiquitin-like protein 4A; GDX, structural genomic	98.32
1wx7_A		106	Ubiquilin 3; ubiquitin-like domain, structural gen	98.32
3mtn_B		85	UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit	98.3
1yqb_A		100	Ubiquilin 3; structural genomics consortium, ubiqu	98.28
3n3k_B		85	Ubiquitin; hydrolase, protease, thiol protease, DU	98.28
2hj8_A		88	Interferon-induced 17 kDa protein; HR2873B, human	98.27
2kan_A		94	Uncharacterized protein AR3433A; ubiquitin fold, a	98.27
3v6c_B		91	Ubiquitin; structural genomics, structural genomic	98.26
4b4t_V		306	26S proteasome regulatory subunit RPN11; hydrolase	98.25
1wh3_A		87	59 kDa 2'-5'-oligoadenylate synthetase like protei	98.23
4hcn_B		98	Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas	98.21
4fbj_B		88	NEDD8; effector-HOST target complex, glutamine dea	98.19
3k9o_B		96	Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b	98.17
2ojr_A		111	Ubiquitin; lanthide-binding TAG, terbium, TB, SAD	98.16
1wxv_A		92	BAG-family molecular chaperone regulator-1; struct	98.15
3dbh_I		88	NEDD8; cell cycle, activating enzyme, apoptosis, m	98.14
2wyq_A		85	HHR23A, UV excision repair protein RAD23 homolog A	98.13
1uel_A		95	HHR23B, UV excision repair protein RAD23 homolog B	98.13
3b1l_X		76	E3 ubiquitin-protein ligase parkin; proteasome, AL	97.37
3b08_A		152	Polyubiquitin-C, ubiquitin; protein complex, signa	98.08
2klc_A		101	Ubiquilin-1; ubiquitin-like, structural genomics,	98.07
4dwf_A		90	HLA-B-associated transcript 3; ubiquitin-like doma	98.07
3m62_B		106	UV excision repair protein RAD23; armadillo-like r	98.06
2uyz_B		79	Small ubiquitin-related modifier 1; sumoylation, c	98.06
1sif_A		88	Ubiquitin; hydrophobic mutants, folding, stability	98.05
1uh6_A		100	Ubiquitin-like 5; beta-grAsp fold, structural geno	98.05
3plu_A		93	Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-	98.03
3vdz_A		111	Ubiquitin-40S ribosomal protein S27A; gadolinium,	98.02
1wgg_A		96	Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti	98.02
1we6_A		111	Splicing factor, putative; structural genomics, ub	98.01
1ttn_A		106	DC-UBP, dendritic cell-derived ubiquitin-like prot	97.99
3m63_B		101	Ubiquitin domain-containing protein DSK2; armadill	97.99
1wx8_A		96	Riken cDNA 4931431F19; ubiquitin-like domain, ubiq	97.98
2dzm_A		100	FAS-associated factor 1; ubiquitin-like domain, HF	97.96
1wia_A		95	Hypothetical ubiquitin-like protein (riken cDNA 20	97.96
2kd0_A		85	LRR repeats and ubiquitin-like domain-containing p	97.94
2l7r_A		93	Ubiquitin-like protein FUBI; structural genomics,	97.93
1wyw_B		97	Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho	97.93
4eew_A		88	Large proline-rich protein BAG6; ubiquitin-like fo	97.93
2kk8_A		84	Uncharacterized protein AT4G05270; solution arabid	97.93
1v86_A		95	DNA segment, CHR 7, wayne state university 128, ex	97.92
1j8c_A		125	Ubiquitin-like protein hplic-2; ubiquitin-like dom	97.92
1v5t_A		90	8430435I17RIK protein; hypothetical protein, ubiqu	97.89
3b08_A		152	Polyubiquitin-C, ubiquitin; protein complex, signa	97.85
3l0w_B		169	Monoubiquitinated proliferating cell nuclear antig	97.83
1wgd_A		93	Homocysteine-responsive endoplasmic reticulum- res	97.82
2dzj_A		88	Synaptic glycoprotein SC2; ubiquitin-like fold, st	97.8
2kjr_A		95	CG11242; UBL, ubiquitin, ubiquitin-like, structura	97.79
4dbg_A		105	Ranbp-type and C3HC4-type zinc finger-containing;	97.76
1v6e_A		95	Cytoskeleton-associated protein 1; tubulin-specifi	97.76
1x1m_A		107	Ubiquitin-like protein SB132; structural genomics,	97.71
4ajy_B		118	Transcription elongation factor B polypeptide 2; E	97.68
3u30_A		172	Ubiquitin, linear DI-ubiquitin; immune system; 2.4	97.67
3q3f_A		189	Ribonuclease/ubiquitin chimeric protein; domain SW	97.67
3rt3_B		159	Ubiquitin-like protein ISG15; ubiquitin-like domai	97.66
2fnj_B		118	Transcription elongation factor B polypeptide 2; b	97.66
2kdb_A		99	Homocysteine-responsive endoplasmic reticulum- res	97.64
2kj6_A		97	Tubulin folding cofactor B; methods development, N	97.63
3u5e_m		128	60S ribosomal protein L40; translation, ribosome,	97.61
1v2y_A		105	3300001G02RIK protein; hypothetical protein, ubiqu	97.6
1wm3_A		72	Ubiquitin-like protein SMT3B; ubiquitin fold, half	97.57
3rt3_B		159	Ubiquitin-like protein ISG15; ubiquitin-like domai	97.57
1t0y_A		122	Tubulin folding cofactor B; ubiquitin-like, cytosk	97.56
3a4r_A		79	Nfatc2-interacting protein; ubiquitin fold, coiled	97.55
1wju_A		100	NEDD8 ultimate buster-1; ubiquitin-like domain, st	97.54
3u5c_f		152	40S ribosomal protein S31; translation, ribosome,	97.53
2kdi_A		114	Ubiquitin, vacuolar protein sorting-associated pro	97.52
4a20_A		98	Ubiquitin-like protein MDY2; protein binding, GET-	97.48
1we7_A		115	SF3A1 protein; structural genomics, ubiquitin-like	97.48
2io0_B		91	Small ubiquitin-related modifier 2 precursor; SUMO	97.38
1wjn_A		97	Tubulin-folding protein TBCE; ubiquitin-like domai	97.36
2io1_B		94	Small ubiquitin-related modifier 3 precursor; SUMO	97.36
4b6w_A		86	Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik	97.35
3u30_A		172	Ubiquitin, linear DI-ubiquitin; immune system; 2.4	97.32
2lxa_A		87	Ubiquitin-like protein MDY2; ubiquitin-like domain	97.24
2d07_B		93	Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho	97.24
3ai5_A		307	Yeast enhanced green fluorescent protein, ubiquit;	97.23
3qx1_A		84	FAS-associated factor 1; UBX, protein binding, P97	97.18
1wz0_A		104	Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li	97.18
2daf_A		118	FLJ35834 protein; hypothetical protein FLJ35834, u	96.92
2dzk_A		109	UBX domain-containing protein 2; ubiquitin-like fo	96.88
2k8h_A		110	Small ubiquitin protein; SUMO, post-translational	96.77
2eke_C		106	Ubiquitin-like protein SMT3; UBC9, SUMO binding mo	96.64
1wgh_A		116	Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo	96.58
1se9_A		126	Ubiquitin family; ubiquitin-like, cell-free, wheat	96.58
2kks_A		146	Uncharacterized protein; NESG, structural genomics	96.56
3shq_A		320	UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila	96.56
2cr5_A		109	Reproduction 8; UBX domain, D0H8S2298E protein, st	96.3
1oqy_A		368	HHR23A, UV excision repair protein RAD23 homolog A	96.23
2gow_A		125	HCG-1 protein, ubiquitin-like protein 3; BC059385,	96.19
2kcq_A		153	MOV34/MPN/PAD-1 family; NESG, structure, structura	96.18
1wj4_A		124	KIAA0794 protein; UBX domain, beta-grAsp fold, str	95.64
2jxx_A		97	Nfatc2-interacting protein; nuclear factor of acti	95.61
3kyd_D		115	Small ubiquitin-related modifier 1; SUMO, thioeste	95.59
2xzm_9		189	RPS31E; ribosome, translation; 3.93A {Tetrahymena	94.44
1s3s_G		127	P47 protein; AAA ATPase, protein-protein complex,	94.32
2kc2_A		128	Talin-1, F1; FERM, adhesion, cell membrane, cell p	94.22
2al3_A		90	TUG long isoform; TUG UBL1 insulin, endocytosis/ex	93.72
3goe_A		82	DNA repair protein RAD60; SUMO-like domain, sumoyl	93.13
3pge_A		200	SUMO-modified proliferating cell nuclear antigen;	91.9
2l76_A		95	Nfatc2-interacting protein; ubiquitin-like domain,	91.47
2o95_A		187	26S proteasome non-ATPase regulatory subunit 7; PS	90.76
3tix_A		207	Ubiquitin-like protein SMT3, RNA-induced transcri	90.56
3onh_A		127	Ubiquitin-activating enzyme E1-like; ligase, SUMO	86.54
3jyu_A		231	Ubiquitin carboxyl-terminal hydrolase; domain in u	85.73
4a3p_A		217	Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H	84.09
1oey_A		83	P67-PHOX, neutrophil cytosol factor 2; immune syst	82.69
1y8x_B		98	Ubiquitin-activating enzyme E1C; ubiquitin-conjuga	80.31

>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus}	Back alignment and structure

Probab=99.72  E-value=2.6e-18  Score=137.59  Aligned_cols=73  Identities=25%  Similarity=0.439  Sum_probs=60.2

Q ss_pred             CEEEEEcCCCceEEEecCCCCcHHHHHHHHHhhcCCCCCCceee--ccccccccCCCCcccccccCCCCCCCcccccccc
Q 015194            1 MLLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLS--TNQNLLLAKSPSDLLQFTDMANPDRPLSSLNISH   78 (411)
Q Consensus         1 MilRvRS~~G~~Rv~v~~p~~t~~~L~~kI~~~l~~~~~~~~Ls--~~~~~~~~~~p~~~~~~~~l~~~~~tl~~lGLkH   78 (411)
                      |+||||||+||+||+|+ |++|+++|+++|+++++++.+.++++  .+|+.          ++.  .+++.+|+++||+|
T Consensus         5 m~lRvrs~~G~~Ri~v~-~~~t~~~L~~~I~~~~~i~~~~~~l~~~~~p~~----------~l~--~~~~~~l~~lgl~h   71 (80)
T 2pjh_A            5 IIIRVQSPDGVKRITAT-KRETAATFLKKVAKEFGFQNNGFSVYINRNKTG----------EIT--ASSSKSLHLLKIKH   71 (80)
T ss_dssp             CCCEEECSSEEEECCCC-SSCCHHHHHHHHHHHTCCCTTTCCCCCSCCGGG----------GSS--SCCCCTTTTTCCCT
T ss_pred             EEEEEECCCCCEEEEcC-CcChHHHHHHHHHHHcCCCCCcceEEecCCCCC----------ccc--CCCCCCHHHcCCCC
Confidence            89999999999999999 69999999999999999998887774  44421          011  24689999999999


Q ss_pred             ccEEEEee
Q 015194           79 GSIVFLSY   86 (411)
Q Consensus        79 GDml~l~y   86 (411)
                      ||||||..
T Consensus        72 Gd~l~l~~   79 (80)
T 2pjh_A           72 GDLLFLFP   79 (80)
T ss_dssp             TCCEEC--
T ss_pred             CCEEEEec
Confidence            99999863

PyMOL of 2pjh

>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1	Back alignment and structure

>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus}	Back alignment and structure

>3rzv_A STAM-binding protein; ubiquitin hydrolase, endosome-associated deubiquitinat enzyme, hydrolase; 1.67A {Homo sapiens} PDB: 3rzu_A	Back alignment and structure

>2znr_A AMSH-like protease; metal binding protein, alternative splicing, hydrolase, metal-binding, metalloprotease, UBL conjugation pathway, zinc; 1.20A {Homo sapiens} PDB: 2znv_A	Back alignment and structure

>2p8r_A PRP8, PRE-mRNA-splicing factor PRP8; alpha-beta, translation; 2.10A {Caenorhabditis elegans} PDB: 2p87_A	Back alignment and structure

>2og4_A PRE-mRNA-splicing factor 8; isopeptidase, JAB1/MPN domain, protein-PR interaction, PRP8P, pseudoenzyme, spliceosome activation; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3sbg_A PRE-mRNA-splicing factor 8; PRP8P, rnaseh domain, JAB1/MPN domain; 3.28A {Saccharomyces cerevisiae}	Back alignment and structure

>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A	Back alignment and structure

>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ...	Back alignment and structure

>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B	Back alignment and structure

>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens}	Back alignment and structure

>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S	Back alignment and structure

>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens}	Back alignment and structure

>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana}	Back alignment and structure

>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B	Back alignment and structure

>4b4t_V 26S proteasome regulatory subunit RPN11; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B	Back alignment and structure

>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A	Back alignment and structure

>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens}	Back alignment and structure

>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I	Back alignment and structure

>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A	Back alignment and structure

>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A	Back alignment and structure

>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B	Back alignment and structure

>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens}	Back alignment and structure

>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A	Back alignment and structure

>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B	Back alignment and structure

>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A	Back alignment and structure

>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A	Back alignment and structure

>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1	Back alignment and structure

>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana}	Back alignment and structure

>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens}	Back alignment and structure

>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C	Back alignment and structure

>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens}	Back alignment and structure

>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana}	Back alignment and structure

>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A	Back alignment and structure

>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B	Back alignment and structure

>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B	Back alignment and structure

>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster}	Back alignment and structure

>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A	Back alignment and structure

>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A*	Back alignment and structure

>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens}	Back alignment and structure

>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens}	Back alignment and structure

>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A	Back alignment and structure

>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A	Back alignment and structure

>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens}	Back alignment and structure

>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana}	Back alignment and structure

>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p	Back alignment and structure

>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B	Back alignment and structure

>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A	Back alignment and structure

>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1	Back alignment and structure

>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A	Back alignment and structure

>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f	Back alignment and structure

>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A	Back alignment and structure

>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A	Back alignment and structure

>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927}	Back alignment and structure

>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens}	Back alignment and structure

>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A	Back alignment and structure

>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B*	Back alignment and structure

>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A	Back alignment and structure

>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A	Back alignment and structure

>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei}	Back alignment and structure

>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1	Back alignment and structure

>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1	Back alignment and structure

>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1	Back alignment and structure

>2kks_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; NMR {Desulfitobacterium hafniense}	Back alignment and structure

>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster}	Back alignment and structure

>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2	Back alignment and structure

>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A	Back alignment and structure

>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens}	Back alignment and structure

>2kcq_A MOV34/MPN/PAD-1 family; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Salinibacter ruber dsm 13855}	Back alignment and structure

>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2	Back alignment and structure

>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens}	Back alignment and structure

>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1	Back alignment and structure

>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9	Back alignment and structure

>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A	Back alignment and structure

>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus}	Back alignment and structure

>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2	Back alignment and structure

>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A*	Back alignment and structure

>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens}	Back alignment and structure

>2o95_A 26S proteasome non-ATPase regulatory subunit 7; PSMD7, MOV34, JAB1/MPN, metal-free dimer, UN function; HET: SO4 12P ETE PG4 PGE; 1.95A {Homo sapiens} PDB: 2o96_A	Back alignment and structure

>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A	Back alignment and structure

>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus}	Back alignment and structure

>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A	Back alignment and structure

>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2	Back alignment and structure

>1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		411
d1wf9a1		94	d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cres	5e-42
d1v2ya_		105	d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik	2e-05
d1wxva1		81	d.15.1.1 (A:7-87) Bag-family molecular chaperone r	3e-04
d1wx8a1		83	d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul	4e-04
d1t0ya_		90	d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol	0.001
d1wjna_		97	d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse	0.002
d1j8ca_		103	d.15.1.1 (A:) Ubiquitin-like N-terminal domain of	0.002
d1wy8a1		76	d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing	0.004
d1yqba1		84	d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien	0.004
d2bwfa1		73	d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc	0.004

>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 94	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: NPL4-like protein 1
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  141 bits (356), Expect = 5e-42
 Identities = 64/93 (68%), Positives = 85/93 (91%)

Query: 2  LLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQF 61
          +LR+RSRDGLERV+VDG H+TV++LKT+IQ QL+IP+ +QTLSTN+NLLLAKSPSD L F
Sbjct: 2  MLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAF 61

Query: 62 TDMANPDRPLSSLNISHGSIVFLSYDGERNVRG 94
          TDMA+P+  +SSLN++HGS+V+L+Y+GER +RG
Sbjct: 62 TDMADPNLRISSLNLAHGSMVYLAYEGERTIRG 94

PyMOL of d1wf9a1

>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105	Back information, alignment and structure

>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81	Back information, alignment and structure

>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83	Back information, alignment and structure

>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90	Back information, alignment and structure

>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97	Back information, alignment and structure

>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76	Back information, alignment and structure

>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		411
d1wf9a1		94	NPL4-like protein 1 {Thale cress (Arabidopsis thal	99.84
d1bt0a_		73	Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI	98.46
d2bwfa1		73	DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta	98.37
d1ogwa_		76	Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}	98.36
d1wy8a1		76	Ubiquitin-like PHD and RING finger domain-containi	98.36
d1v5oa_		102	1700011n24rik protein {Mouse (Mus musculus) [TaxId	98.34
d1j8ca_		103	Ubiquitin-like N-terminal domain of PLIC-2 {Human	98.28
d2faza1		76	Ubiquitin-like PHD and RING finger domain-containi	98.27
d1yqba1		84	Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]}	98.22
d1wx8a1		83	4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]	98.2
d1z2ma1		76	Interferon-induced 15 kDa protein {Human (Homo sap	98.2
d1z2ma2		76	Interferon-induced 15 kDa protein {Human (Homo sap	98.15
d1m94a_		73	Ubiquitin-like modifier protein hub1 {Baker's yeas	98.13
d2zeqa1		78	Ubiquitin-like domain of parkin {Mouse (Mus muscul	98.12
d1wh3a_		87	2'-5'-oligoadenylate synthetase-like protein, OASL	98.06
d1wgga_		96	Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M	98.03
d1uela_		95	Ubiquitin-like domain of Rad23 homolog B (Hhr23B)	97.95
d1v2ya_		105	Ubiquitin-like protein 3300001g02rik {Mouse (Mus m	97.94
d1wxva1		81	Bag-family molecular chaperone regulator-1 {Human	97.93
d1ttna1		80	Dendritic cell-derived ubiquitin-like protein {Hum	97.88
d1uh6a_		100	Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu	97.87
d1v86a_		95	hypothetical D7wsu128e protein {Mouse (Mus musculu	97.84
d1v5ta_		90	8430435i17rik protein {Mouse (Mus musculus) [TaxId	97.78
d1oqya4		77	Ubiquitin-like domain of Rad23 homolog A (Hhr23a)	97.73
d1wjna_		97	Tubulin-folding protein TbcE {Mouse (Mus musculus)	97.66
d1wx9a1		73	Large proline-rich protein BAT3 {Human (Homo sapie	97.61
d1we6a_		111	Splicing factor 3 subunit 1, C-terminal domain {Th	97.59
d1euvb_		79	SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy	97.53
d1zkha1		86	Splicing factor 3 subunit 1, C-terminal domain {Hu	97.47
d1wjua_		100	NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens	97.42
d1wiaa_		95	Ubiquitin-like protein bab25500 (2010008E23Rik) {M	97.42
d2uyzb1		77	SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax	97.34
d1wgha_		116	Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu	97.25
d1se9a_		101	Hypothetical protein At3g01050 {Thale cress (Arabi	97.04
d1wgda_		93	Homocysteine-responsive endoplasmic reticulum-resi	97.03
d1t0ya_		90	Ubiquitin-like domain of tubulin folding cofactor	97.01
d2c9wb1		103	Elongin B {Human (Homo sapiens) [TaxId: 9606]}	97.01
d1wm3a_		72	SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}	96.81
d1v6ea_		95	Ubiquitin-like domain of tubulin folding cofactor	96.81
d1i42a_		89	p47 {Rat (Rattus norvegicus) [TaxId: 10116]}	96.64
d1h8ca_		82	Fas-associated factor 1, Faf1 {Human (Homo sapiens	96.5
d2cr5a1		96	UBX domain-containing protein 6 (Reproduction 8) {	96.05
d1x1ma1		94	Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta	94.83
d1wj4a_		124	Hypothetical protein KIAA0794 {Human (Homo sapiens	94.65
d1y8xb1		92	UBA3 {Human (Homo sapiens) [TaxId: 9606]}	84.73
d2al3a1		76	Tether containing UBX domain for GLUT4 (Tug) {Mous	83.26
d1wgra_		100	Growth factor receptor-bound protein 7, GRB-7 {Hum	81.41

>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: NPL4-like protein 1
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.84  E-value=1.3e-21  Score=156.34  Aligned_cols=92  Identities=68%  Similarity=1.114  Sum_probs=83.5

Q ss_pred             EEEEEcCCCceEEEecCCCCcHHHHHHHHHhhcCCCCCCceeeccccccccCCCCcccccccCCCCCCCccccccccccE
Q 015194            2 LLRIRSRDGLERVTVDGAHVTVAELKTIIQSQLRIPVESQTLSTNQNLLLAKSPSDLLQFTDMANPDRPLSSLNISHGSI   81 (411)
Q Consensus         2 ilRvRS~~G~~Rv~v~~p~~t~~~L~~kI~~~l~~~~~~~~Ls~~~~~~~~~~p~~~~~~~~l~~~~~tl~~lGLkHGDm   81 (411)
                      |||+||++|+.||+|+++++|+++|+++|++.+++|.+.|+||.||+.+++|+|..-..+.++++++.+|+++||.||.|
T Consensus         2 iiRiRsrdG~eRv~v~~~~~Tl~~LK~~Ie~~L~VPv~~Q~LSl~~~llL~k~P~~~~~~~~l~d~~~~L~sl~i~hGsi   81 (94)
T d1wf9a1           2 MLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAFTDMADPNLRISSLNLAHGSM   81 (94)
T ss_dssp             EEEEECSSCEEEEEECCTTSBHHHHHHHHHHHSCCCTTTCCCBSSGGGGTCCSHHHHTTCCSSCCTTCBGGGTCCCTTCE
T ss_pred             eEEEEecCCceEEEecCCCCcHHHHHHHHHHHhCCCcccceeecChhhhccCCccccchhhhccCCccCHHHcCccCceE
Confidence            89999999999999975578999999999999999999999999999999999864334677888899999999999999


Q ss_pred             EEEeecCccccC
Q 015194           82 VFLSYDGERNVR   93 (411)
Q Consensus        82 l~l~y~~~~~~~   93 (411)
                      |||.|+.++.++
T Consensus        82 vyL~y~~~r~i~   93 (94)
T d1wf9a1          82 VYLAYEGERTIR   93 (94)
T ss_dssp             EECCCSSCCCCC
T ss_pred             EEEEeeeeeccC
Confidence            999999988655

PyMOL of d1wf9a1

>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}	Back information, alignment and structure

>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure