Citrus Sinensis ID: 015242


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-
MVMGDTESSSSRAVDFVWSESKSRKQRVKVQVYNEILFRLKQSNEEETRQPYFEDDLWAHFYRLPSRYALDVNLERAEDVLMHKRLLHVARDPAATPAIEVRLVLVQGASTRHFSNLVHSGSPRYLYTQFSCYPYKKRLMHEITISTNDKPKLLSQLTSLLSEIGLNIQEAHAFSTVDGYSLDVFVVDGWPLQETEQLRNVLAKEIPKVENHHHVVYPVGEQEQSGINHVNIPAEGIDVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSISTVILVIFSCILVRA
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEEEEcccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcccccccccccccccccEEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEccccEEEEEEccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccEEEccccEEEcccccccccccccccEEEccc
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHccccHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHccHccccccccccEEEccccccEEEEEEEccccccccHHHcHHHHHHHHcccccccEccEEEEccccccccEEEEcccccEHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHEEEcccccEEEcccccEcccccEEEEEEccEEEEEEEc
mvmgdtessssravdfvwsesksrkqRVKVQVYNEILFRLKqsneeetrqpyfeddlwahfyrlpsryalDVNLERAEDVLMHKRLLHvardpaatpAIEVRLVLVQGastrhfsnlvhsgsprylytqfscypykkrlmheitistndkpKLLSQLTSLLSEIGLNIQeahafstvdgysldvfvvdgwplqeTEQLRNVLAKeipkvenhhhvvypvgeqeqsginhvnipaegidvWEIDASLLKFEHkivsgsycdlykgaffSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFigactrpprlFIVTEFmsggsiydylhkqkcglklPLLLRVAIDVskgmnylhrnnIIHRDLKAANLLMnengvrdsdihcylsNFLSISTVILVIFSCILVRA
mvmgdtessssravdfvwsesksrkqrvkvQVYNEILFrlkqsneeetrqPYFEDDLWAHFYRLPSRYALDVNLERAEDVLMHKRLLHVardpaatpAIEVRLVLVQGASTRHfsnlvhsgsprylyTQFSCYPYKKRLMHEITISTNDKPKLLSQLTSLLSEIGLNIQEAHAFSTVDGYSLDVFVVDGWPLQETEQLRNVLAKEIPKVENHHHVVYPVGEQEQSGINHVNIPAEGIDVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSISTVILVIFSCILVRA
MVMGDTESSSSRAVDFVWSESKSRKQRVKVQVYNEILFRLKQSNEEETRQPYFEDDLWAHFYRLPSRYALDVNLERAEDVLMHKRLLHVARDPAATPAIEVRLVLVQGASTRHFSNLVHSGSPRYLYTQFSCYPYKKRLMHEITISTNDKPKLLSQLTSLLSEIGLNIQEAHAFSTVDGYSLDVFVVDGWPLQETEQLRNVLAKEIPKVENHHHVVYPVGEQEQSGINHVNIPAEGIDVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSISTVILVIFSCILVRA
***************************VKVQVYNEILFRLK********QPYFEDDLWAHFYRLPSRYALDVNLERAEDVLMHKRLLHVARDPAATPAIEVRLVLVQGASTRHFSNLVHSGSPRYLYTQFSCYPYKKRLMHEITISTNDKPKLLSQLTSLLSEIGLNIQEAHAFSTVDGYSLDVFVVDGWPLQETEQLRNVLAKEIPKVENHHHVVYPVGEQEQSGINHVNIPAEGIDVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSISTVILVIFSCILV**
**********************************EILFRLKQS****TRQPYFEDDLWAHFYRLPSRYALDVNLERAEDVLMHKRLLHVARDPAATPAIEVRLVL************************************EITISTNDKPKLLSQLTSLLSEIGLNIQEAHAFSTVDGYSLDVFVVDGWP*********************************************IDVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSISTVILVIFSCILVRA
***************************VKVQVYNEILFRLKQSNEEETRQPYFEDDLWAHFYRLPSRYALDVNLERAEDVLMHKRLLHVARDPAATPAIEVRLVLVQGASTRHFSNLVHSGSPRYLYTQFSCYPYKKRLMHEITISTNDKPKLLSQLTSLLSEIGLNIQEAHAFSTVDGYSLDVFVVDGWPLQETEQLRNVLAKEIPKVENHHHVVYPVGEQEQSGINHVNIPAEGIDVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSISTVILVIFSCILVRA
*************************QRVKVQVYNEILFRLKQSNEEETRQPYFEDDLWAHFYRLPSRYALDVNLERAEDVLMHKRLLHVARDPAATPAIEVRLVLVQGA*************************YKKRLMHEITISTNDKPKLLSQLTSLLSEIGLNIQEAHAFSTVDGYSLDVFVVDGWPLQETEQLRNVLAKEIPKVEN*******************NIPAEGIDVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSISTVILVIFSCILVRA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMGDTESSSSRAVDFVWSESKSRKQRVKVQVYNEILFRLKQSNEEETRQPYFEDDLWAHFYRLPSRYALDVNLERAEDVLMHKRLLHVARDPAATPAIEVRLVLVQGASTRHFSNLVHSGSPRYLYTQFSCYPYKKRLMHEITISTNDKPKLLSQLTSLLSEIGLNIQEAHAFSTVDGYSLDVFVVDGWPLQETEQLRNVLAKEIPKVENHHHVVYPVGEQEQSGINHVNIPAEGIDVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSISTVILVIFSCILVRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query411 2.2.26 [Sep-21-2011]
Q55GU0916 Probable serine/threonine yes no 0.335 0.150 0.424 4e-28
Q54H46 642 Probable serine/threonine no no 0.345 0.221 0.430 5e-28
Q5UQG7 1651 Putative serine/threonine N/A no 0.340 0.084 0.425 8e-27
Q54H45 690 Probable serine/threonine no no 0.345 0.205 0.409 3e-26
Q7T6Y2 1624 Putative serine/threonine N/A no 0.335 0.084 0.410 1e-25
Q2MHE4 390 Serine/threonine-protein no no 0.338 0.356 0.388 5e-25
Q05609 821 Serine/threonine-protein no no 0.347 0.174 0.422 1e-24
Q54Y55 506 Dual specificity protein no no 0.357 0.290 0.402 5e-24
P00521 746 Tyrosine-protein kinase t yes no 0.394 0.217 0.337 6e-24
P00520 1123 Tyrosine-protein kinase A yes no 0.394 0.144 0.337 8e-24
>sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 Back     alignment and function desciption
 Score =  125 bits (315), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 92/139 (66%), Gaps = 1/139 (0%)

Query: 241 EIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIK-VLTNEHLNENIRREFAQEVHIMRKV 299
           EI  S LK   K+  G++  +YKG +    VAIK +  NE +N  +  EF +E+ I+ ++
Sbjct: 656 EISFSELKISSKLGEGTFGVVYKGLWRGSSVAIKQIKINEDVNNQVLEEFRKELTILSRL 715

Query: 300 RHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYL 359
           RH N+V  + ACT PP L  +TE++ GGS+YD LH +K  + + L  ++AI +++GMNYL
Sbjct: 716 RHPNIVLLMAACTAPPNLCFITEYLPGGSLYDALHSKKIKMNMQLYKKLAIQIAQGMNYL 775

Query: 360 HRNNIIHRDLKAANLLMNE 378
           H + +IHRD+K+ NLL++E
Sbjct: 776 HLSGVIHRDIKSLNLLLDE 794





Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q54H46|DRKA_DICDI Probable serine/threonine-protein kinase drkA OS=Dictyostelium discoideum GN=drkA PE=3 SV=1 Back     alignment and function description
>sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=4 SV=1 Back     alignment and function description
>sp|Q54H45|DRKB_DICDI Probable serine/threonine-protein kinase drkB OS=Dictyostelium discoideum GN=drkB PE=3 SV=1 Back     alignment and function description
>sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=4 SV=2 Back     alignment and function description
>sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 Back     alignment and function description
>sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 Back     alignment and function description
>sp|Q54Y55|SHKC_DICDI Dual specificity protein kinase shkC OS=Dictyostelium discoideum GN=shkC PE=3 SV=1 Back     alignment and function description
>sp|P00521|ABL_MLVAB Tyrosine-protein kinase transforming protein Abl OS=Abelson murine leukemia virus GN=ABL PE=3 SV=1 Back     alignment and function description
>sp|P00520|ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus GN=Abl1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query411
297744550 580 unnamed protein product [Vitis vinifera] 0.924 0.655 0.6 1e-135
255539096 749 protein kinase, putative [Ricinus commun 0.912 0.500 0.660 1e-134
359474826 1515 PREDICTED: uncharacterized mscS family p 0.924 0.250 0.568 1e-132
449454245 573 PREDICTED: protein-tyrosine kinase 2-bet 0.924 0.663 0.598 1e-131
224080668494 predicted protein [Populus trichocarpa] 0.824 0.686 0.645 1e-127
283132359 578 ACT-domain-containing protein kinase [Lo 0.927 0.659 0.559 1e-124
255560441 558 protein kinase, putative [Ricinus commun 0.892 0.657 0.576 1e-124
224143785 539 predicted protein [Populus trichocarpa] 0.907 0.692 0.617 1e-122
224083191 556 predicted protein [Populus trichocarpa] 0.909 0.672 0.599 1e-121
224065733 565 predicted protein [Populus trichocarpa] 0.902 0.656 0.589 1e-121
>gi|297744550|emb|CBI37812.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  488 bits (1256), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 261/435 (60%), Positives = 303/435 (69%), Gaps = 55/435 (12%)

Query: 1   MVMGDTESSSSRAVDFVWSESKSRKQRVKVQVYNEILFRLKQSNEEETRQPYFEDDLWAH 60
           MVM D ES SSR  D   S ++SR+QR K++VYNE+L RLK S+ EE  +P F+++LWAH
Sbjct: 1   MVMEDNESCSSRVHDSS-SPAQSRQQRQKLEVYNEVLRRLKDSDNEEAFEPGFDEELWAH 59

Query: 61  FYRLPSRYALDVNLERAEDVLMHKRLLHVARDPAATPAIEVRLVLVQGASTRHFSNLVHS 120
           F RLP+RYALDVN+ERAEDVL HKRLLH+A DP   PAIEVRLV V   S     N+  S
Sbjct: 60  FVRLPTRYALDVNVERAEDVLTHKRLLHLAHDPTNRPAIEVRLVQVHPISDGIHGNIADS 119

Query: 121 ------------GSPRYLYTQ-------FSCYP--------------------------- 134
                       GSP+Y   Q       F   P                           
Sbjct: 120 IHSNSPTIGPAHGSPKYSSKQSILPPPAFGSSPNLEALAIEANNSHVQDGDGDDSVHASS 179

Query: 135 YKKRLMHEITISTNDKPKLLSQLTSLLSEIGLNIQEAHAFSTVDGYSLDVFVVDGWPLQE 194
              R MHEIT S++DKPKLLSQLT LLSE+ LNIQEAHAFSTVDGYSLDVFVVDGWP +E
Sbjct: 180 QYSRPMHEITFSSDDKPKLLSQLTCLLSELELNIQEAHAFSTVDGYSLDVFVVDGWPYEE 239

Query: 195 TEQLRNVLAKEIPKVEN----HHHVVYPVGEQEQSGI----NHVNIPAEGIDVWEIDASL 246
           TEQLR  L KE+ K+E     +HH + P GEQE++GI    + V IP +G DVWEID   
Sbjct: 240 TEQLRTALEKEVFKIEKQSWPNHHSLSPTGEQEETGIKCESDFVTIPNDGTDVWEIDVRQ 299

Query: 247 LKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQ 306
           LKFE+K+ SGSY DLYKG + SQ+VAIKVL  E LN ++++EFAQEV IMRKVRH NVVQ
Sbjct: 300 LKFENKVASGSYGDLYKGTYCSQEVAIKVLKPERLNSDMQKEFAQEVFIMRKVRHKNVVQ 359

Query: 307 FIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIH 366
           FIGACTRPP L+IVTEFMSGGS+YDYLHKQK   KLP LL+V+IDVSKGMNYLH+NNIIH
Sbjct: 360 FIGACTRPPSLYIVTEFMSGGSVYDYLHKQKGVFKLPALLKVSIDVSKGMNYLHQNNIIH 419

Query: 367 RDLKAANLLMNENGV 381
           RDLKAANLLM+EN V
Sbjct: 420 RDLKAANLLMDENEV 434




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255539096|ref|XP_002510613.1| protein kinase, putative [Ricinus communis] gi|223551314|gb|EEF52800.1| protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359474826|ref|XP_002280985.2| PREDICTED: uncharacterized mscS family protein At1g78610-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449454245|ref|XP_004144866.1| PREDICTED: protein-tyrosine kinase 2-beta-like [Cucumis sativus] gi|449528766|ref|XP_004171374.1| PREDICTED: protein-tyrosine kinase 2-beta-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224080668|ref|XP_002306203.1| predicted protein [Populus trichocarpa] gi|222849167|gb|EEE86714.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|283132359|dbj|BAI63585.1| ACT-domain-containing protein kinase [Lotus japonicus] Back     alignment and taxonomy information
>gi|255560441|ref|XP_002521235.1| protein kinase, putative [Ricinus communis] gi|223539503|gb|EEF41091.1| protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224143785|ref|XP_002336079.1| predicted protein [Populus trichocarpa] gi|222871184|gb|EEF08315.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224083191|ref|XP_002306961.1| predicted protein [Populus trichocarpa] gi|222856410|gb|EEE93957.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224065733|ref|XP_002301944.1| predicted protein [Populus trichocarpa] gi|222843670|gb|EEE81217.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query411
TAIR|locus:2121154 575 STY46 "serine/threonine/tyrosi 0.593 0.424 0.673 4.8e-114
TAIR|locus:2827943546 STY8 "serine/threonine/tyrosin 0.591 0.445 0.626 1.2e-104
TAIR|locus:2128043 570 STY17 "serine/threonine/tyrosi 0.591 0.426 0.615 4.6e-101
DICTYBASE|DDB_G0289791 642 drkA "DRK subfamily protein ki 0.338 0.216 0.432 1.5e-27
DICTYBASE|DDB_G0267514916 DDB_G0267514 "protein kinase, 0.379 0.170 0.412 1.7e-27
DICTYBASE|DDB_G0289709 690 drkB "DRK subfamily protein ki 0.338 0.201 0.411 1.6e-25
TAIR|locus:2027794 1030 AT1G73660 [Arabidopsis thalian 0.316 0.126 0.462 5.7e-25
TAIR|locus:2200296 765 AT1G67890 [Arabidopsis thalian 0.386 0.207 0.407 1.5e-24
TAIR|locus:2061092 411 AT2G24360 [Arabidopsis thalian 0.372 0.372 0.388 2.7e-24
TAIR|locus:2143009 880 AT5G11850 [Arabidopsis thalian 0.681 0.318 0.277 4.1e-24
TAIR|locus:2121154 STY46 "serine/threonine/tyrosine kinase 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 830 (297.2 bits), Expect = 4.8e-114, Sum P(2) = 4.8e-114
 Identities = 169/251 (67%), Positives = 192/251 (76%)

Query:   138 RLMHEITISTNDKPKLLSQLTSLLSEIGLNIQEAHAFSTVDGYSLDVFVVDGWPLQETEQ 197
             R +HEIT ST DKPKLL QLT+LL+E+GLNIQEAHAFST DGYSLDVFVVDGWP +ETE+
Sbjct:   174 RPLHEITFSTEDKPKLLFQLTALLAELGLNIQEAHAFSTTDGYSLDVFVVDGWPYEETER 233

Query:   198 LRNVLAKEIPKVENH------HHVVYPVGEQEQSGIN-HVNIPAEGIDVWEIDASLLKFE 250
             LR  L KE  K+E             P  E  Q+G   HV IP +G DVWEI+   LKF 
Sbjct:   234 LRISLEKEAAKIELQSQSWPMQQSFSPEKENGQTGARTHVPIPNDGTDVWEINLKHLKFG 293

Query:   251 HKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGA 310
             HKI SGSY DLYKG + SQ+VAIKVL  E L+ ++ +EFAQEV IMRKVRH NVVQFIGA
Sbjct:   294 HKIASGSYGDLYKGTYCSQEVAIKVLKPERLDSDLEKEFAQEVFIMRKVRHKNVVQFIGA 353

Query:   311 CTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLK 370
             CT+PP L IVTEFM GGS+YDYLHKQK   KLP L +VAID+ KGM+YLH+NNIIHRDLK
Sbjct:   354 CTKPPHLCIVTEFMPGGSVYDYLHKQKGVFKLPTLFKVAIDICKGMSYLHQNNIIHRDLK 413

Query:   371 AANLLMNENGV 381
             AANLLM+EN V
Sbjct:   414 AANLLMDENEV 424


GO:0004672 "protein kinase activity" evidence=IEA;ISS
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0016597 "amino acid binding" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0004712 "protein serine/threonine/tyrosine kinase activity" evidence=ISS
GO:0005829 "cytosol" evidence=IDA
GO:0009658 "chloroplast organization" evidence=IGI
GO:0007015 "actin filament organization" evidence=RCA
TAIR|locus:2827943 STY8 "serine/threonine/tyrosine kinase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128043 STY17 "serine/threonine/tyrosine kinase 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289791 drkA "DRK subfamily protein kinase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267514 DDB_G0267514 "protein kinase, TKL group" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289709 drkB "DRK subfamily protein kinase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2027794 AT1G73660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200296 AT1G67890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061092 AT2G24360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143009 AT5G11850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query411
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-40
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 4e-40
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 2e-38
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-34
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-33
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-31
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-30
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 1e-29
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 1e-29
cd0492868 cd04928, ACT_TyrKc, Uncharacterized, N-terminal AC 2e-29
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 6e-29
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 4e-28
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 1e-27
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 3e-27
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 6e-26
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 8e-25
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 6e-24
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 8e-24
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 4e-23
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 4e-23
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 5e-23
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 8e-23
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 1e-22
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 2e-22
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-22
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 4e-22
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 4e-22
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 6e-22
cd06614 286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-21
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 1e-20
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-20
cd06609 274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 4e-20
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 1e-19
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 1e-19
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 2e-19
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 2e-19
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 2e-19
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 2e-19
cd07833 288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 3e-19
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 3e-19
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 7e-19
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 2e-18
cd05065 269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 5e-18
cd07829 282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 6e-18
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 8e-18
cd05057 279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-17
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 1e-17
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 2e-17
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 2e-17
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 3e-17
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 3e-17
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 4e-17
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 4e-17
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 8e-17
cd05118 283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 2e-16
cd06611 280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 4e-16
cd0490073 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UU 4e-16
cd05079 284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 5e-16
cd07846 286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 7e-16
cd05089 297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 7e-16
cd06621 287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 7e-16
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 1e-15
cd05110 303 cd05110, PTKc_HER4, Catalytic domain of the Protei 2e-15
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 2e-15
cd05081 284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 3e-15
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 4e-15
cd07840 287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 4e-15
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 7e-15
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 1e-14
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 1e-14
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 1e-14
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-14
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 2e-14
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 2e-14
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 4e-14
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 4e-14
cd05088 303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 5e-14
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 6e-14
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 9e-14
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 1e-13
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 1e-13
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-13
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 2e-13
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 2e-13
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 3e-13
cd05080 283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 3e-13
cd06642 277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 4e-13
PLN00034 353 PLN00034, PLN00034, mitogen-activated protein kina 4e-13
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 5e-13
cd06629 272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 5e-13
cd06917 277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 5e-13
cd06641 277 cd06641, STKc_MST3, Catalytic domain of the Protei 6e-13
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 7e-13
cd07832 286 cd07832, STKc_CCRK, Catalytic domain of the Serine 8e-13
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 1e-12
cd05108 316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 1e-12
cd06640 277 cd06640, STKc_MST4, Catalytic domain of the Protei 2e-12
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 2e-12
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 3e-12
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 3e-12
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 5e-12
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 6e-12
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 7e-12
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 8e-12
cd06644 292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 9e-12
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 1e-11
cd05100 334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 1e-11
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 2e-11
cd05099 314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 2e-11
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 2e-11
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 2e-11
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 3e-11
cd07865 310 cd07865, STKc_CDK9, Catalytic domain of the Serine 3e-11
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 3e-11
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 3e-11
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 4e-11
cd07841 298 cd07841, STKc_CDK7, Catalytic domain of the Serine 5e-11
cd07861 285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 7e-11
cd06647 293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 8e-11
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 8e-11
cd05579 265 cd05579, STKc_MAST_like, Catalytic domain of Micro 9e-11
cd07866 311 cd07866, STKc_BUR1, Catalytic domain of the Serine 1e-10
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 1e-10
cd05109 279 cd05109, PTKc_HER2, Catalytic domain of the Protei 2e-10
cd06619 279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 2e-10
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 2e-10
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 2e-10
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 2e-10
cd06620 284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 2e-10
cd07836 284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-10
cd06648 285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 2e-10
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 3e-10
PHA02988283 PHA02988, PHA02988, hypothetical protein; Provisio 4e-10
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 7e-10
cd05087 269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 7e-10
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 9e-10
cd05042 269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 1e-09
cd06643 282 cd06643, STKc_SLK, Catalytic domain of the Protein 1e-09
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 1e-09
cd06655 296 cd06655, STKc_PAK2, Catalytic domain of the Protei 2e-09
cd06607 307 cd06607, STKc_TAO, Catalytic domain of the Protein 2e-09
cd06634 308 cd06634, STKc_TAO2, Catalytic domain of the Protei 2e-09
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 2e-09
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 2e-09
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-09
cd07860 284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 2e-09
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-09
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 3e-09
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 3e-09
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 3e-09
cd05111 279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 4e-09
cd06659 297 cd06659, STKc_PAK6, Catalytic domain of the Protei 4e-09
cd06658 292 cd06658, STKc_PAK5, Catalytic domain of the Protei 4e-09
cd08216 314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 4e-09
cd07847 286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 4e-09
cd06617 283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 4e-09
cd07834 330 cd07834, STKc_MAPK, Catalytic domain of the Serine 6e-09
cd05077262 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) do 6e-09
cd06656 297 cd06656, STKc_PAK3, Catalytic domain of the Protei 6e-09
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 8e-09
cd07858 337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 9e-09
cd07845 309 cd07845, STKc_CDK10, Catalytic domain of the Serin 9e-09
cd06633 313 cd06633, STKc_TAO3, Catalytic domain of the Protei 1e-08
cd06622 286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 1e-08
cd06635 317 cd06635, STKc_TAO1, Catalytic domain of the Protei 1e-08
cd06657 292 cd06657, STKc_PAK4, Catalytic domain of the Protei 2e-08
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-08
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 2e-08
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 2e-08
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-08
cd06654 296 cd06654, STKc_PAK1, Catalytic domain of the Protei 2e-08
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 2e-08
cd07848 287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 2e-08
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 3e-08
cd05061 288 cd05061, PTKc_InsR, Catalytic domain of the Protei 3e-08
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 3e-08
cd06650 333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 4e-08
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 4e-08
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 5e-08
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 5e-08
cd07835 283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 6e-08
cd08226 328 cd08226, PK_STRAD_beta, Pseudokinase domain of STE 6e-08
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 7e-08
cd07873 301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 8e-08
cd06615 308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 9e-08
PRK05092931 PRK05092, PRK05092, PII uridylyl-transferase; Prov 1e-07
cd07831 282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 1e-07
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 1e-07
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 2e-07
cd06649 331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 2e-07
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 2e-07
cd05076274 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) do 2e-07
cd05577 277 cd05577, STKc_GRK, Catalytic domain of the Protein 2e-07
cd05611 260 cd05611, STKc_Rim15_like, Catalytic domain of fung 3e-07
cd07843 293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 3e-07
cd07856 328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 4e-07
PHA03212 391 PHA03212, PHA03212, serine/threonine kinase US3; P 4e-07
cd05572 262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 4e-07
cd05590 320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 5e-07
cd07870 291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 5e-07
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 7e-07
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 1e-06
cd07855 334 cd07855, STKc_ERK5, Catalytic domain of the Serine 1e-06
cd07871 288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 1e-06
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 2e-06
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 2e-06
cd07839 284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-06
PTZ00263 329 PTZ00263, PTZ00263, protein kinase A catalytic sub 2e-06
cd05604 325 cd05604, STKc_SGK3, Catalytic domain of the Protei 2e-06
cd07869 303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 2e-06
cd07872 309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 2e-06
cd05615 323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 2e-06
cd05591 321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 3e-06
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 3e-06
cd07859 338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 3e-06
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 3e-06
cd05587 324 cd05587, STKc_cPKC, Catalytic domain of the Protei 3e-06
TIGR01693850 TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans 4e-06
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 4e-06
cd05630 285 cd05630, STKc_GRK6, Catalytic domain of the Protei 5e-06
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 5e-06
cd07842 316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 6e-06
cd07844 291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 7e-06
cd07864 302 cd07864, STKc_CDK12, Catalytic domain of the Serin 7e-06
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 9e-06
cd07851 343 cd07851, STKc_p38, Catalytic domain of the Serine/ 1e-05
cd05607 277 cd05607, STKc_GRK7, Catalytic domain of the Protei 1e-05
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 1e-05
cd05608 280 cd05608, STKc_GRK1, Catalytic domain of the Protei 1e-05
cd0211660 cd02116, ACT, ACT domains are commonly involved in 1e-05
PHA03209 357 PHA03209, PHA03209, serine/threonine kinase US3; P 1e-05
cd05107 401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 1e-05
cd06616 288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 2e-05
cd0489970 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain 2e-05
COG2844867 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran 2e-05
cd05586 330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 2e-05
PRK00275895 PRK00275, glnD, PII uridylyl-transferase; Provisio 2e-05
cd05632 285 cd05632, STKc_GRK5, Catalytic domain of the Protei 3e-05
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 3e-05
cd05086 268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 3e-05
COG3642204 COG3642, COG3642, Mn2+-dependent serine/threonine 4e-05
cd05105 400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 4e-05
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 4e-05
cd08227 327 cd08227, PK_STRAD_alpha, Pseudokinase domain of ST 5e-05
cd07862 290 cd07862, STKc_CDK6, Catalytic domain of the Serine 6e-05
PLN00009 294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 6e-05
cd07854 342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 6e-05
cd05605 285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 8e-05
cd07880 343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 8e-05
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 8e-05
cd05592 316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 9e-05
cd07849 336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 9e-05
cd07838 287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 9e-05
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 1e-04
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 1e-04
cd07878 343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 1e-04
cd05616 323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 2e-04
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-04
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 2e-04
cd05103 343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 2e-04
cd05606 278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 2e-04
pfam0184266 pfam01842, ACT, ACT domain 2e-04
PTZ00426 340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 3e-04
PRK05007884 PRK05007, PRK05007, PII uridylyl-transferase; Prov 3e-04
cd07837 295 cd07837, STKc_CdkB_plant, Catalytic domain of the 3e-04
cd05633 279 cd05633, STKc_GRK3, Catalytic domain of the Protei 4e-04
cd07877 345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 5e-04
PHA03207 392 PHA03207, PHA03207, serine/threonine kinase US3; P 5e-04
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 6e-04
cd07879 342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 6e-04
PTZ00024 335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 7e-04
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 8e-04
PHA03211 461 PHA03211, PHA03211, serine/threonine kinase US3; P 8e-04
cd07863 288 cd07863, STKc_CDK4, Catalytic domain of the Serine 9e-04
cd07857 332 cd07857, STKc_MPK1, Catalytic domain of the Serine 0.001
cd07853 372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 0.001
PTZ00036 440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 0.001
cd05620 316 cd05620, STKc_nPKC_delta, Catalytic domain of the 0.001
cd05621 370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 0.001
PRK05092931 PRK05092, PRK05092, PII uridylyl-transferase; Prov 0.002
TIGR01693850 TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans 0.002
cd05102 338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 0.002
cd07874 355 cd07874, STKc_JNK3, Catalytic domain of the Serine 0.002
PTZ00267 478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 0.002
cd07875 364 cd07875, STKc_JNK1, Catalytic domain of the Serine 0.002
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 0.002
cd05576237 cd05576, STKc_RPK118_like, Catalytic domain of the 0.002
cd0492672 cd04926, ACT_ACR_4, C-terminal ACT domain, of a no 0.003
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 0.003
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 0.004
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
cd05585 312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 0.004
cd05596 370 cd05596, STKc_ROCK, Catalytic domain of the Protei 0.004
cd05106 374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 0.004
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
 Score =  144 bits (366), Expect = 1e-40
 Identities = 57/141 (40%), Positives = 83/141 (58%), Gaps = 7/141 (4%)

Query: 247 LKFEHKIVSGSYCDLYKG------AFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVR 300
           L+   K+  G++ ++YKG            VA+K L  E  +E  R EF +E  IM+K+ 
Sbjct: 1   LELGKKLGEGAFGEVYKGTLKGDGEGTETKVAVKTL-KEGASEEEREEFLEEASIMKKLS 59

Query: 301 HMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLH 360
           H N+V+ +G CT+   L+IVTE+M GG + D+L K    L L  LL++A+ ++KGM YL 
Sbjct: 60  HPNIVRLLGVCTQGEPLYIVTEYMPGGDLLDFLRKHGEKLTLKDLLQMALQIAKGMEYLE 119

Query: 361 RNNIIHRDLKAANLLMNENGV 381
             N +HRDL A N L+ EN V
Sbjct: 120 SKNFVHRDLAARNCLVTENLV 140


Length = 258

>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|153200 cd04928, ACT_TyrKc, Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|153172 cd04900, ACT_UUR-like_1, ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|133207 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|226168 COG3642, COG3642, Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|190133 pfam01842, ACT, ACT domain Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|235329 PRK05007, PRK05007, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 411
KOG0197 468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0192 362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.97
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 99.97
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 99.96
KOG0193 678 consensus Serine/threonine protein kinase RAF [Sig 99.96
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.96
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.96
KOG0581 364 consensus Mitogen-activated protein kinase kinase 99.96
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 99.96
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 99.96
KOG0194 474 consensus Protein tyrosine kinase [Signal transduc 99.96
KOG0598 357 consensus Ribosomal protein S6 kinase and related 99.96
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.96
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 99.96
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.95
KOG1187 361 consensus Serine/threonine protein kinase [Signal 99.95
KOG0583 370 consensus Serine/threonine protein kinase [Signal 99.95
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.95
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.95
KOG0605 550 consensus NDR and related serine/threonine kinases 99.95
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 99.94
KOG0198 313 consensus MEKK and related serine/threonine protei 99.94
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 99.94
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.94
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 99.94
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.94
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.94
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.94
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.94
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.94
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.94
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.94
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.94
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.94
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.94
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.94
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.94
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.94
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.94
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.94
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.94
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.94
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.94
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.94
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.94
KOG1094 807 consensus Discoidin domain receptor DDR1 [Signal t 99.93
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.93
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.93
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.93
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.93
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.93
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.93
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.93
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.93
KOG1026 774 consensus Nerve growth factor receptor TRKA and re 99.93
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.93
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.93
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.93
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.93
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.93
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.93
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.93
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.93
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.93
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.93
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.93
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.93
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.93
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.93
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.93
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.93
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.93
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.93
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.93
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.92
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.92
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.92
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.92
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.92
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.92
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.92
KOG0586 596 consensus Serine/threonine protein kinase [General 99.92
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.92
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.92
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.92
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.92
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.92
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.92
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.92
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.92
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.92
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.92
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.92
PHA02988283 hypothetical protein; Provisional 99.92
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 99.92
KOG0610 459 consensus Putative serine/threonine protein kinase 99.92
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.92
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.92
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.92
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.92
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.92
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.92
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.92
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.92
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.92
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.92
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.92
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.92
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.92
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.92
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.92
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.92
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.92
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.92
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.92
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.92
KOG0589 426 consensus Serine/threonine protein kinase [General 99.92
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.92
KOG0694 694 consensus Serine/threonine protein kinase [Signal 99.92
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.92
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.92
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.92
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.92
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.92
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.92
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.92
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.91
PHA03212 391 serine/threonine kinase US3; Provisional 99.91
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.91
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.91
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.91
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.91
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.91
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.91
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.91
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 99.91
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.91
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.91
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.91
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.91
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.91
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.91
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.91
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.91
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.91
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.91
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.91
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.91
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.91
PTZ00267 478 NIMA-related protein kinase; Provisional 99.91
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.91
PTZ00283 496 serine/threonine protein kinase; Provisional 99.91
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.91
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.91
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.91
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.91
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.91
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.91
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.91
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.91
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.91
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.91
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.91
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.91
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.91
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.91
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.91
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.91
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.91
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.91
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.91
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.91
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.91
KOG0578 550 consensus p21-activated serine/threonine protein k 99.91
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.91
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.91
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.91
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.91
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.91
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.91
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.91
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.91
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.91
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.91
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.91
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.91
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.91
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.91
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.91
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.9
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.9
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.9
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.9
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.9
PTZ00036 440 glycogen synthase kinase; Provisional 99.9
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.9
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.9
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.9
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.9
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.9
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.9
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.9
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.9
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.9
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.9
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.9
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.9
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 99.9
PHA03209 357 serine/threonine kinase US3; Provisional 99.9
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.9
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.9
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.9
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.9
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.9
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.9
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.9
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.9
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.9
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.9
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.9
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.9
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.9
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.9
PHA03207 392 serine/threonine kinase US3; Provisional 99.9
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.9
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.9
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.9
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.9
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.9
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.9
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.9
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.9
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.9
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.9
cd05043 280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.9
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.9
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.9
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.9
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.9
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.9
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.9
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.9
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.9
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.9
PHA03211 461 serine/threonine kinase US3; Provisional 99.9
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.9
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.9
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.9
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.89
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.89
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.89
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.89
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.89
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.89
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.89
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.89
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.89
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.89
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.89
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.89
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.89
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.89
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.89
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.89
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.89
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.89
PLN00009 294 cyclin-dependent kinase A; Provisional 99.89
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.89
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.89
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.89
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.89
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.89
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.89
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.89
PRK09188 365 serine/threonine protein kinase; Provisional 99.89
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.89
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.89
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.89
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.89
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.89
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.89
KOG2052 513 consensus Activin A type IB receptor, serine/threo 99.89
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.89
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.89
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.89
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.89
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.89
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.88
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.88
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.88
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.88
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.88
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.88
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.88
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.88
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.88
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.88
KOG3653 534 consensus Transforming growth factor beta/activin 99.88
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.88
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.88
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.88
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 99.88
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.88
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.88
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.88
PTZ00284 467 protein kinase; Provisional 99.88
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.88
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.88
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 99.88
PHA03210 501 serine/threonine kinase US3; Provisional 99.88
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.88
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.88
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.88
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.88
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.88
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.88
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.88
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.88
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.88
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 99.87
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 99.87
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.87
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.87
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.87
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.87
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.87
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 99.87
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 99.87
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.87
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.87
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.87
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.87
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.87
KOG0584 632 consensus Serine/threonine protein kinase [General 99.87
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.87
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.87
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.87
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.87
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.87
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.87
cd06618 296 PKc_MKK7 Catalytic domain of the dual-specificity 99.87
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.87
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.87
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.87
KOG0607 463 consensus MAP kinase-interacting kinase and relate 99.87
KOG0200 609 consensus Fibroblast/platelet-derived growth facto 99.87
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.86
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.86
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.86
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.86
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.86
KOG0690 516 consensus Serine/threonine protein kinase [Signal 99.86
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.86
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 99.86
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.86
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.86
KOG1152772 consensus Signal transduction serine/threonine kin 99.86
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.86
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.86
cd06616 288 PKc_MKK4 Catalytic domain of the dual-specificity 99.86
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.86
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.86
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.86
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.85
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.85
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.85
PHA02882 294 putative serine/threonine kinase; Provisional 99.85
KOG2345 302 consensus Serine/threonine protein kinase/TGF-beta 99.85
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.85
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.85
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.85
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.85
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.84
KOG4645 1509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.84
PLN03224 507 probable serine/threonine protein kinase; Provisio 99.84
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.84
PRK10345210 hypothetical protein; Provisional 99.84
KOG0596 677 consensus Dual specificity; serine/threonine and t 99.83
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.83
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.83
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.82
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.82
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 99.82
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.82
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.82
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.82
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 99.81
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.81
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 99.8
PRK14879211 serine/threonine protein kinase; Provisional 99.8
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 99.8
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.79
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.79
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 99.79
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 99.79
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.79
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.79
KOG0670 752 consensus U4/U6-associated splicing factor PRP4 [R 99.78
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.78
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.78
smart00090237 RIO RIO-like kinase. 99.77
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.77
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.77
KOG0695 593 consensus Serine/threonine protein kinase [Signal 99.77
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.76
PRK12274218 serine/threonine protein kinase; Provisional 99.76
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 99.75
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.75
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 99.75
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.74
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 99.73
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.72
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.72
KOG1167 418 consensus Serine/threonine protein kinase of the C 99.71
COG0515 384 SPS1 Serine/threonine protein kinase [General func 99.71
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.7
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.68
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.67
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 99.6
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.49
KOG1024 563 consensus Receptor-like protein tyrosine kinase RY 99.46
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.39
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.39
PLN00181 793 protein SPA1-RELATED; Provisional 99.38
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 99.35
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.35
KOG3087229 consensus Serine/threonine protein kinase [General 99.33
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.32
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.28
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.26
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.12
KOG4158 598 consensus BRPK/PTEN-induced protein kinase [Signal 99.06
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 99.05
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.01
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 98.97
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.96
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.91
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 98.88
KOG0590 601 consensus Checkpoint kinase and related serine/thr 98.78
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.78
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.64
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.62
KOG1243 690 consensus Protein kinase [General function predict 98.56
KOG0606 1205 consensus Microtubule-associated serine/threonine 98.55
COG0661 517 AarF Predicted unusual protein kinase [General fun 98.5
smart00750 176 KIND kinase non-catalytic C-lobe domain. It is an 98.46
COG0478304 RIO-like serine/threonine protein kinase fused to 98.45
PRK09902216 hypothetical protein; Provisional 98.39
KOG1235 538 consensus Predicted unusual protein kinase [Genera 98.36
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 98.32
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.25
PF01636239 APH: Phosphotransferase enzyme family This family 98.23
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 98.21
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 98.18
KOG1266 458 consensus Protein kinase [Signal transduction mech 98.15
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 98.12
COG1718268 RIO1 Serine/threonine protein kinase involved in c 98.11
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 98.09
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 98.08
PRK05092931 PII uridylyl-transferase; Provisional 98.06
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 98.01
PRK00275895 glnD PII uridylyl-transferase; Provisional 97.99
PRK03059856 PII uridylyl-transferase; Provisional 97.91
PRK04374869 PII uridylyl-transferase; Provisional 97.86
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 97.81
PLN02876 822 acyl-CoA dehydrogenase 97.8
PRK05007884 PII uridylyl-transferase; Provisional 97.76
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 97.62
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 97.61
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 97.6
PRK01759854 glnD PII uridylyl-transferase; Provisional 97.5
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 97.49
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 97.22
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 97.17
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 97.09
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 97.06
PRK05231 319 homoserine kinase; Provisional 97.01
PRK09550 401 mtnK methylthioribose kinase; Reviewed 96.86
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 96.84
cd05156 302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 96.65
KOG0606 1205 consensus Microtubule-associated serine/threonine 96.61
KOG2270 520 consensus Serine/threonine protein kinase involved 96.6
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 96.56
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 96.54
KOG2268 465 consensus Serine/threonine protein kinase [Signal 96.49
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 96.27
PRK10593 297 hypothetical protein; Provisional 96.23
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 96.1
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 95.87
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 95.78
PLN02236 344 choline kinase 95.73
KOG0576 829 consensus Mitogen-activated protein kinase kinase 95.49
TIGR01767 370 MTRK 5-methylthioribose kinase. This enzyme is inv 95.41
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 95.2
PLN02421 330 phosphotransferase, alcohol group as acceptor/kina 95.17
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 95.02
PLN02756 418 S-methyl-5-thioribose kinase 94.77
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 94.68
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=7e-38  Score=317.72  Aligned_cols=248  Identities=28%  Similarity=0.403  Sum_probs=198.2

Q ss_pred             CcceeEEEEeeCChhhHHHHHhhhccccC-cccccccccccCCCceeEEEEecCCCccchHHHHHHHhhccccccCCCCc
Q 015242          137 KRLMHEITISTNDKPKLLSQLTSLLSEIG-LNIQEAHAFSTVDGYSLDVFVVDGWPLQETEQLRNVLAKEIPKVENHHHV  215 (411)
Q Consensus       137 ~~~~~e~~~~~~d~~klls~l~~~l~~~g-l~i~ea~~fst~~g~sLdvfvvd~w~~~~~~~l~~~l~~~i~~~~~~~~~  215 (411)
                      +....+|+|+.+.|.++..+|.+..+..| ++|++..  ++.++|+|+|+..+.=.  ..+   ...++++...+...-.
T Consensus        77 ~l~~~~Wf~~~isR~~ae~~ll~p~~~~G~flvR~se--~~~g~yslsv~~~~~~~--~~~---~v~hyri~~~~~~~~~  149 (468)
T KOG0197|consen   77 KLSDEPWFFGKISREEAERQLLAPENKEGAFLVRESE--SDKGDYSLSVREGDSGG--LGA---KVKHYRIRQLDGGGLY  149 (468)
T ss_pred             ccccCCchhccccHHHHHHhhcCCCCCccceeeeccc--CCcCCeeEEEEeccccC--Ccc---ceeeeeeeEcCCCCee
Confidence            47788999999999999999999999888 8889999  99999999999865111  000   1113344333322100


Q ss_pred             cccc------------------Cccccc--Ccccc----cCCC---CCCcceeecCCCeEEEEEEeecCceEEEEEEECC
Q 015242          216 VYPV------------------GEQEQS--GINHV----NIPA---EGIDVWEIDASLLKFEHKIVSGSYCDLYKGAFFS  268 (411)
Q Consensus       216 ~~~~------------------~~~~~~--~~~~~----~~~~---~~~~~~ei~~~~~~~~~~IG~Gsfg~Vy~g~~~~  268 (411)
                      .+..                  ......  ..++.    ..|.   ...+.|+|+++.+++.++||+|.||.||.|.|++
T Consensus       150 ~~~~~~~~F~~l~~lv~~~~~~~~gl~~~l~~p~~~~~~~~p~~~~~~~d~wei~r~~l~l~~~LG~G~FG~V~~g~~~~  229 (468)
T KOG0197|consen  150 PYIDERELFSSLQQLVNYYSKNADGLCTRLRDPCSKQGHTKPQTPDLARDPWEIPREELKLIRELGSGQFGEVWLGKWNG  229 (468)
T ss_pred             cCCCHHHhhhhHHHHHhhhhccCcchhhcccCchhccCCCCCCCCccccCCeeecHHHHHHHHHhcCCccceEEEEEEcC
Confidence            0000                  000000  00110    1122   2278999999999999999999999999999997


Q ss_pred             c-eEEEEEeeccccCHHHHHHHHHHHHHHhhcCCCceeEEEeeeecCCeEEEEEecCCCCCHHHHHHh-cCCCCCHHHHH
Q 015242          269 Q-DVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHK-QKCGLKLPLLL  346 (411)
Q Consensus       269 ~-~VAIK~l~~~~~~~~~~~~~~~Ei~iL~~l~HpNIV~l~g~~~~~~~l~IV~Ey~~gGsL~~~L~~-~~~~l~~~~i~  346 (411)
                      + +||+|.++...+..   +.|.+|+++|++++|+|||+++|+|+.+..+|||||||+.|+|.+||+. .+..+..+..+
T Consensus       230 ~~~vavk~ik~~~m~~---~~f~~Ea~iMk~L~H~~lV~l~gV~~~~~piyIVtE~m~~GsLl~yLr~~~~~~l~~~~Ll  306 (468)
T KOG0197|consen  230 STKVAVKTIKEGSMSP---EAFLREAQIMKKLRHEKLVKLYGVCTKQEPIYIVTEYMPKGSLLDYLRTREGGLLNLPQLL  306 (468)
T ss_pred             CCcccceEEeccccCh---hHHHHHHHHHHhCcccCeEEEEEEEecCCceEEEEEecccCcHHHHhhhcCCCccchHHHH
Confidence            5 99999999876654   6788999999999999999999999998899999999999999999997 45578999999


Q ss_pred             HHHHHHHHHHHHHHHCCccccCCCCCcEEEccCCCcCCCccEEEEecCcccccc
Q 015242          347 RVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSISTVI  400 (411)
Q Consensus       347 ~i~~qIa~gL~yLH~~gIIHRDLKp~NILld~~g~~k~~~~ikL~DFG~a~~~~  400 (411)
                      .++.|||+||+||+++++|||||.++|||+++++      .+||+|||+|+.+.
T Consensus       307 ~~a~qIaeGM~YLes~~~IHRDLAARNiLV~~~~------~vKIsDFGLAr~~~  354 (468)
T KOG0197|consen  307 DFAAQIAEGMAYLESKNYIHRDLAARNILVDEDL------VVKISDFGLARLIG  354 (468)
T ss_pred             HHHHHHHHHHHHHHhCCccchhhhhhheeeccCc------eEEEcccccccccC
Confidence            9999999999999999999999999999999999      49999999999654



>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query411
3ppz_A 309 Crystal Structure Of Ctr1 Kinase Domain In Complex 1e-25
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 4e-25
3p86_A 309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 4e-25
3dk3_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 8e-25
1fpu_A 293 Crystal Structure Of Abl Kinase Domain In Complex W 1e-24
2qoh_A 288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 1e-24
2f4j_A 287 Structure Of The Kinase Domain Of An Imatinib-Resis 1e-24
2e2b_A 293 Crystal Structure Of The C-Abl Kinase Domain In Com 1e-24
3oxz_A 284 Crystal Structure Of Abl Kinase Domain Bound With A 1e-24
2hiw_A 287 Crystal Structure Of Inactive Conformation Abl Kina 1e-24
2g2f_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 1e-24
3pyy_A 298 Discovery And Characterization Of A Cell-Permeable, 1e-24
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 1e-24
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 2e-24
2g1t_A 287 A Src-Like Inactive Conformation In The Abl Tyrosin 2e-24
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 2e-24
2v7a_A 286 Crystal Structure Of The T315i Abl Mutant In Comple 2e-24
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 2e-24
3dk6_A 293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-24
1opk_A 495 Structural Basis For The Auto-Inhibition Of C-Abl T 4e-24
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 4e-24
2fo0_A 495 Organization Of The Sh3-Sh2 Unit In Active And Inac 6e-24
2z60_A 288 Crystal Structure Of The T315i Mutant Of Abl Kinase 7e-24
3oy3_A 284 Crystal Structure Of Abl T315i Mutant Kinase Domain 7e-24
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 7e-24
1opl_A 537 Structural Basis For The Auto-Inhibition Of C-Abl T 8e-24
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 3e-23
3c4c_A 280 B-Raf Kinase In Complex With Plx4720 Length = 280 5e-23
4fk3_A 292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 5e-23
3og7_A 289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 8e-23
3omv_A 307 Crystal Structure Of C-Raf (Raf-1) Length = 307 1e-22
2fb8_A 281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 5e-22
1uwj_A 276 The Complex Of Mutant V599e B-raf And Bay439006 Len 5e-22
4dbn_A 284 Crystal Structure Of The Kinase Domain Of Human B-R 5e-22
3oez_A 286 Crystal Structure Of The L317i Mutant Of The Chicke 6e-22
3q96_A 282 B-Raf Kinase Domain In Complex With A Tetrahydronap 6e-22
4h58_A 275 Braf In Complex With Compound 3 Length = 275 6e-22
3idp_A 300 B-Raf V600e Kinase Domain In Complex With An Aminoi 6e-22
3d4q_A 307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 6e-22
4g9r_A 307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 6e-22
3ii5_A 306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 6e-22
2oiq_A 286 Crystal Structure Of Chicken C-Src Kinase Domain In 9e-22
2h8h_A 535 Src Kinase In Complex With A Quinazoline Inhibitor 1e-21
2bdf_A 279 Src Kinase In Complex With Inhibitor Ap23451 Length 1e-21
1fmk_A 452 Crystal Structure Of Human Tyrosine-Protein Kinase 1e-21
2ptk_A 453 Chicken Src Tyrosine Kinase Length = 453 1e-21
1y57_A 452 Structure Of Unphosphorylated C-Src In Complex With 1e-21
1uwh_A 276 The Complex Of Wild Type B-Raf And Bay439006 Length 1e-21
3d7u_B 277 Structural Basis For The Recognition Of C-Src By It 2e-21
3geq_A 286 Structural Basis For The Chemical Rescue Of Src Kin 2e-21
1yi6_A 276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 3e-21
2hwo_A 286 Crystal Structure Of Src Kinase Domain In Complex W 3e-21
3svv_A 286 Crystal Structure Of T338c C-Src Covalently Bound T 5e-21
3dqw_A 286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 5e-21
3g6h_A 286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 5e-21
1ksw_A 452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 6e-21
1yoj_A 283 Crystal Structure Of Src Kinase Domain Length = 283 7e-21
1yol_A 283 Crystal Structure Of Src Kinase Domain In Complex W 8e-21
3u4w_A 275 Src In Complex With Dna-Templated Macrocyclic Inhib 9e-21
2qq7_A 286 Crystal Structure Of Drug Resistant Src Kinase Doma 2e-20
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 2e-20
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 3e-20
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 3e-20
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 4e-20
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 6e-20
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 7e-20
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 7e-20
2y4i_B 319 Ksr2-Mek1 Heterodimer Length = 319 1e-19
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 2e-19
2dq7_X 283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 9e-19
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 1e-18
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 1e-18
3a4o_X 286 Lyn Kinase Domain Length = 286 1e-18
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 2e-18
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 2e-18
2zv7_A 279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 3e-18
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 4e-18
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 5e-18
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 5e-18
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 5e-18
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 5e-18
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 2e-17
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 3e-17
3kxz_A 287 The Complex Crystal Structure Of Lck With A Probe M 4e-17
2zm1_A 285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 5e-17
2pl0_A 289 Lck Bound To Imatinib Length = 289 5e-17
3kmm_A 288 Structure Of Human Lck Kinase With A Small Molecule 6e-17
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 6e-17
1qpe_A 279 Structural Analysis Of The Lymphocyte-Specific Kina 6e-17
2ofv_A 277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 6e-17
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 7e-17
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 7e-17
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 7e-17
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 8e-17
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 8e-17
1qpd_A 279 Structural Analysis Of The Lymphocyte-specific Kina 9e-17
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 1e-16
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 3e-16
1qcf_A 454 Crystal Structure Of Hck In Complex With A Src Fami 3e-16
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 4e-16
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 1e-15
1jpa_A 312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 1e-15
2rei_A 318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 2e-15
4aw5_A 291 Complex Of The Ephb4 Kinase Domain With An Oxindole 4e-15
2vwu_A 302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 4e-15
2r4b_A 321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 1e-14
2hen_A 286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 1e-14
2hel_A 306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 1e-14
3bbt_B 328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 1e-14
2xyu_A 285 Crystal Structure Of Epha4 Kinase Domain In Complex 1e-14
2y6m_A 291 Crystal Structure Of Epha4 Kinase Domain Length = 2 1e-14
2r2p_A 295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 2e-14
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 2e-14
2qoo_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 6e-14
2nry_A 307 Crystal Structure Of Irak-4 Length = 307 7e-14
2nru_A 307 Crystal Structure Of Irak-4 Length = 307 7e-14
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 8e-14
3dzq_A 361 Human Epha3 Kinase Domain In Complex With Inhibitor 8e-14
2oib_A 301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 8e-14
2qoi_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 9e-14
3fxx_A 371 Human Epha3 Kinase And Juxtamembrane Region Bound T 9e-14
2qof_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 9e-14
2qod_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 9e-14
2qok_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 9e-14
2qol_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 9e-14
2gsf_A 373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 9e-14
3s95_A 310 Crystal Structure Of The Human Limk1 Kinase Domain 1e-13
2qon_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-13
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 2e-13
2oo8_X 317 Synthesis, Structural Analysis, And Sar Studies Of 3e-13
1mqb_A 333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 3e-13
2qo7_A 373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 3e-13
1fvr_A 327 Tie2 Kinase Domain Length = 327 3e-13
4gs6_A 315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 6e-13
3ugc_A 295 Structural Basis Of Jak2 Inhibition By The Type Ii 6e-13
3lpb_A 295 Crystal Structure Of Jak2 Complexed With A Potent 2 6e-13
2eva_A 307 Structural Basis For The Interaction Of Tak1 Kinase 6e-13
3kul_B 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 6e-13
3kul_A 325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 6e-13
2w1i_A 326 Structure Determination Of Aurora Kinase In Complex 6e-13
4e4m_A 302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 7e-13
3tjc_A 298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 7e-13
4hge_A 300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 7e-13
4aqc_A 301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 7e-13
3rvg_A 303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 7e-13
3e62_A 293 Fragment Based Discovery Of Jak-2 Inhibitors Length 7e-13
2b7a_A 293 The Structural Basis Of Janus Kinase 2 Inhibition B 7e-13
3q32_A 301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 8e-13
3jy9_A 311 Janus Kinase 2 Inhibitors Length = 311 9e-13
3io7_A 313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 9e-13
4e6d_A 298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 1e-12
2wqb_A 324 Structure Of The Tie2 Kinase Domain In Complex With 1e-12
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 1e-12
3bz3_A 276 Crystal Structure Analysis Of Focal Adhesion Kinase 1e-12
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 1e-12
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 2e-12
2etm_A 281 Crystal Structure Of Focal Adhesion Kinase Domain C 2e-12
3pxk_A 282 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-12
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 2e-12
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 2e-12
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-12
4e4l_A 302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 2e-12
3eyg_A 290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 2e-12
4bbe_A 298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 3e-12
2x7f_A 326 Crystal Structure Of The Kinase Domain Of Human Tra 3e-12
4hzs_A 341 Crystal Structure Of Ack1 Kinase Domain With C-term 4e-12
2o8y_A 298 Apo Irak4 Kinase Domain Length = 298 4e-12
1u54_A 291 Crystal Structures Of The Phosphorylated And Unphos 4e-12
1u46_A 291 Crystal Structure Of The Unphosphorylated Kinase Do 5e-12
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 5e-12
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 5e-12
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 5e-12
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 5e-12
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 5e-12
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 6e-12
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 6e-12
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 6e-12
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 6e-12
2xa4_A 298 Inhibitors Of Jak2 Kinase Domain Length = 298 1e-11
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 3e-11
3dak_A 290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 3e-11
2vwi_A 303 Structure Of The Osr1 Kinase, A Hypertension Drug T 4e-11
2itn_A 327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 4e-11
2j5f_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 4e-11
2j7t_A 302 Crystal Structure Of Human Serine Threonine Kinase- 4e-11
4i23_A 329 Crystal Structure Of The Wild-type Egfr Kinase Doma 4e-11
3bel_A 315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 4e-11
4bc6_A 293 Crystal Structure Of Human Serine Threonine Kinase- 4e-11
2eb2_A 334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 4e-11
2itt_A 327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 4e-11
4g5j_A 330 Crystal Structure Of Egfr Kinase In Complex With Bi 4e-11
1m14_A 333 Tyrosine Kinase Domain From Epidermal Growth Factor 4e-11
4hjo_A 337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 4e-11
1xkk_A 352 Egfr Kinase Domain Complexed With A Quinazoline Inh 4e-11
3gqi_A 326 Crystal Structure Of Activated Receptor Tyrosine Ki 4e-11
2gs2_A 330 Crystal Structure Of The Active Egfr Kinase Domain 4e-11
2gs7_A 330 Crystal Structure Of The Inactive Egfr Kinase Domai 4e-11
4i20_A 329 Crystal Structure Of Monomeric (v948r) Primary Onco 4e-11
3lzb_A 327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 4e-11
2j5e_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 5e-11
3vjo_A 334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 5e-11
2eb3_A 334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 5e-11
2p2h_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 5e-11
1zmw_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-11
3ewh_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 5e-11
2r0i_A 327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 5e-11
1zmu_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-11
3u6j_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 6e-11
2qnj_A 328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 6e-11
3fe3_A 328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 6e-11
4fnw_A 327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 7e-11
3gop_A 361 Crystal Structure Of The Egf Receptor Juxtamembrane 7e-11
2xik_A 294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 7e-11
3iec_A 319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 7e-11
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 7e-11
2yjr_A 342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 8e-11
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 9e-11
3uim_A 326 Structural Basis For The Impact Of Phosphorylation 9e-11
2hak_A 328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 9e-11
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 9e-11
4fob_A 353 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-10
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 1e-10
2yfx_A 327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 1e-10
4dce_A 333 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-10
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 1e-10
4fnx_A 327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 1e-10
2yhv_A 342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 1e-10
3l9p_A 367 Crystal Structure Of The Anaplastic Lymphoma Kinase 1e-10
3aox_A 344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 1e-10
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-10
4fnz_A 327 Crystal Structure Of Human Anaplastic Lymphoma Kina 1e-10
3ggf_A 301 Crystal Structure Of Human SerineTHREONINE-Protein 1e-10
3gql_A 326 Crystal Structure Of Activated Receptor Tyrosine Ki 1e-10
3lct_A 344 Crystal Structure Of The Anaplastic Lymphoma Kinase 1e-10
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 1e-10
2wzj_A 327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 1e-10
1zmv_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-10
2xb7_A 315 Structure Of Human Anaplastic Lymphoma Kinase In Co 1e-10
2rfd_A 324 Crystal Structure Of The Complex Between The Egfr K 1e-10
2xp2_A 327 Structure Of The Human Anaplastic Lymphoma Kinase I 1e-10
3lxn_A 318 Structural And Thermodynamic Characterization Of Th 1e-10
3ckw_A 304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-10
3a7f_A 303 Human Mst3 Kinase Length = 303 1e-10
3ckx_A 304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-10
3zhp_C 294 Human Mst3 (stk24) In Complex With Mo25beta Length 1e-10
1rw8_A 301 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 1e-10
1py5_A 326 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 1e-10
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 1e-10
1b6c_B 342 Crystal Structure Of The Cytoplasmic Domain Of The 1e-10
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 1e-10
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 1e-10
2wot_A 306 Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl) 2e-10
2yjs_A 342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 2e-10
1vjy_A 303 Crystal Structure Of A Naphthyridine Inhibitor Of H 2e-10
3tzm_A 309 Tgf-Beta Receptor Type 1 In Complex With Sb431542 L 2e-10
1yvj_A 290 Crystal Structure Of The Jak3 Kinase Domain In Comp 2e-10
3tt0_A 382 Co-Structure Of Fibroblast Growth Factor Receptor 1 2e-10
3ika_A 331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 2e-10
2pvf_A 334 Crystal Structure Of Tyrosine Phosphorylated Activa 2e-10
4i21_A 329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 2e-10
3cly_A 334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 2e-10
4i24_A 329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 2e-10
2jiu_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-10
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 2e-10
2jit_A 327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-10
3w2o_A 331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 2e-10
4g5p_A 330 Crystal Structure Of Egfr Kinase T790m In Complex W 2e-10
2p2i_A 314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-10
3ug1_A 334 Crystal Structure Of The Mutated Egfr Kinase Domain 2e-10
2jiv_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-10
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 2e-10
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 2e-10
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 2e-10
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 2e-10
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-10
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-10
4i1z_A 329 Crystal Structure Of The Monomeric (v948r) Form Of 2e-10
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-10
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 2e-10
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 2e-10
3com_A 314 Crystal Structure Of Mst1 Kinase Length = 314 2e-10
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 2e-10
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-10
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 2e-10
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-10
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-10
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 3e-10
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 3e-10
3b2t_A311 Structure Of Phosphotransferase Length = 311 3e-10
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 3e-10
1y8g_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-10
2gcd_A 309 Tao2 Kinase Domain-Staurosporine Structure Length = 4e-10
1u5q_A 348 Crystal Structure Of The Tao2 Kinase Domain: Activa 4e-10
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 4e-10
4hvd_A 314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 4e-10
3lxk_A 327 Structural And Thermodynamic Characterization Of Th 5e-10
3pjc_A 315 Crystal Structure Of Jak3 Complexed With A Potent A 5e-10
4aaa_A 331 Crystal Structure Of The Human Cdkl2 Kinase Domain 5e-10
3mtf_A 301 Crystal Structure Of The Acvr1 Kinase In Complex Wi 5e-10
4dym_A 301 Crystal Structure Of The Acvr1 Kinase Domain In Com 5e-10
3qup_A 323 Inhibitor Bound Structure Of The Kinase Domain Of T 5e-10
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 6e-10
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 6e-10
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 6e-10
1p4o_A 322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 6e-10
4eoj_A 302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 6e-10
3h9r_A 330 Crystal Structure Of The Kinase Domain Of Type I Ac 7e-10
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 7e-10
4eok_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 7e-10
3lw0_A 304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 7e-10
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 7e-10
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 7e-10
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 8e-10
3nyx_A 302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 9e-10
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 9e-10
3lcd_A 329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 9e-10
2zm3_A 308 Complex Structure Of Insulin-Like Growth Factor Rec 1e-09
1m7n_A 322 Crystal Structure Of Unactivated Apo Insulin-Like G 1e-09
3mdy_A 337 Crystal Structure Of The Cytoplasmic Domain Of The 1e-09
3qqu_A 301 Cocrystal Structure Of Unphosphorylated Igf With Py 1e-09
3nz0_A 302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 1e-09
3o23_A 305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 1e-09
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 1e-09
2oj9_A 307 Structure Of Igf-1r Kinase Domain Complexed With A 1e-09
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 1e-09
1jqh_A 308 Igf-1 Receptor Kinase Domain Length = 308 1e-09
1k3a_A 299 Structure Of The Insulin-Like Growth Factor 1 Recep 1e-09
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-09
3i81_A 315 Crystal Structure Of Insulin-Like Growth Factor 1 R 1e-09
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-09
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 1e-09
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-09
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 1e-09
3lvp_A 336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 1e-09
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 2e-09
4e1z_A 291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 2e-09
4e20_A 290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 2e-09
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 2e-09
3pp0_A 338 Crystal Structure Of The Kinase Domain Of Human Her 2e-09
4eoi_A 299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 3e-09
3d94_A 301 Crystal Structure Of The Insulin-Like Growth Factor 3e-09
2j51_A 325 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-09
2jfl_A 325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 3e-09
4aoj_A 329 Human Trka In Complex With The Inhibitor Az-23 Leng 3e-09
2jfm_A 325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 3e-09
4gt5_A 306 Crystal Structure Of The Inactive Trka Kinase Domai 3e-09
4f0i_A 300 Crystal Structure Of Apo Trka Length = 300 3e-09
2uv2_A 287 Crystal Structure Of Human Ste20-Like Kinase Bound 4e-09
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 4e-09
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 4e-09
4eom_A 301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-09
4eon_A 300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-09
3my0_A 305 Crystal Structure Of The Acvrl1 (Alk1) Kinase Domai 5e-09
4ec8_A 373 Structure Of Full Length Cdk9 In Complex With Cycli 5e-09
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 6e-09
3mi9_A 351 Crystal Structure Of Hiv-1 Tat Complexed With Human 6e-09
3kmu_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 7e-09
3blh_A 331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 7e-09
3bea_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 8e-09
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 8e-09
3lmg_A 344 Crystal Structure Of The Erbb3 Kinase Domain In Com 8e-09
2i0v_A 335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 8e-09
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 8e-09
3kex_A 325 Crystal Structure Of The Catalytically Inactive Kin 9e-09
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 9e-09
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 9e-09
1oit_A 299 Imidazopyridines: A Potent And Selective Class Of C 9e-09
4asz_A 299 Crystal Structure Of Apo Trkb Kinase Domain Length 9e-09
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 1e-08
2qkw_B 321 Structural Basis For Activation Of Plant Immunity B 1e-08
3hgk_A 327 Crystal Structure Of Effect Protein Avrptob Complex 1e-08
1u59_A 287 Crystal Structure Of The Zap-70 Kinase Domain In Co 1e-08
2i1m_A 333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 1e-08
1e9h_A 297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 1e-08
1jst_A 298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 1e-08
1gz8_A 299 Human Cyclin Dependent Kinase 2 Complexed With The 1e-08
1w98_A 298 The Structural Basis Of Cdk2 Activation By Cyclin E 1e-08
1pf8_A 298 Crystal Structure Of Human Cyclin-dependent Kinase 1e-08
1vyw_A 309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 1e-08
4fvp_A 289 Crystal Structure Of The Jak2 Pseudokinase Domain ( 2e-08
4i3z_A 296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 2e-08
2iw6_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 2e-08
2w17_A 299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 2e-08
4erw_A 306 Cdk2 In Complex With Staurosporine Length = 306 2e-08
3qhr_A 298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 2e-08
1fin_A 298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 2e-08
1qmz_A 299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 2e-08
4eoo_A 299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-08
3pxf_A 306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 2e-08
4eos_A 300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-08
4eop_A 300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-08
3bht_A 300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 2e-08
3ezr_A 300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 2e-08
2jgz_A 289 Crystal Structure Of Phospho-Cdk2 In Complex With C 2e-08
4eoq_A 301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-08
4bcq_A 301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 2e-08
3pj8_A 299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 2e-08
1ogu_A 302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 2e-08
1h1p_A 303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 2e-08
2pk9_A 317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 2e-08
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 2e-08
3q52_A 306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 3e-08
2ozo_A 613 Autoinhibited Intact Human Zap-70 Length = 613 3e-08
1rqq_A 306 Crystal Structure Of The Insulin Receptor Kinase In 3e-08
1f3m_C 297 Crystal Structure Of Human SerineTHREONINE KINASE P 3e-08
2z8c_A 303 Phosphorylated Insulin Receptor Tyrosine Kinase In 3e-08
1yhv_A 297 Crystal Structure Of Pak1 Kinase Domain With Two Po 3e-08
3fxz_A 297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 3e-08
1i44_A 306 Crystallographic Studies Of An Activation Loop Muta 3e-08
4bcf_A 331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 3e-08
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 3e-08
1irk_A 306 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-08
1ir3_A 306 Phosphorylated Insulin Receptor Tyrosine Kinase In 4e-08
4fvr_A 289 Crystal Structure Of The Jak2 Pseudokinase Domain M 4e-08
3a62_A 327 Crystal Structure Of Phosphorylated P70s6k1 Length 4e-08
3a60_A 327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 4e-08
2clq_A 295 Structure Of Mitogen-Activated Protein Kinase Kinas 4e-08
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 4e-08
2rku_A 294 Structure Of Plk1 In Complex With Bi2536 Length = 2 5e-08
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 5e-08
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 5e-08
3kb7_A 311 Crystal Structure Of Polo-Like Kinase 1 In Complex 5e-08
2yac_A 311 Crystal Structure Of Polo-Like Kinase 1 In Complex 6e-08
2v5q_A 315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-08
3thb_A 333 Structure Of Plk1 Kinase Domain In Complex With A B 6e-08
1gii_A 298 Human Cyclin Dependent Kinase 2 Complexed With The 6e-08
2ou7_A 335 Structure Of The Catalytic Domain Of Human Polo-Lik 6e-08
1oir_A 299 Imidazopyridines: A Potent And Selective Class Of C 7e-08
1h01_A 298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 7e-08
2iw8_A 302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 7e-08
2f57_A 317 Crystal Structure Of The Human P21-activated Kinase 8e-08
2c30_A 321 Crystal Structure Of The Human P21-Activated Kinase 8e-08
3q6w_A 307 Structure Of Dually-phosphorylated Met Receptor Kin 9e-08
2g15_A318 Structural Characterization Of Autoinhibited C-Met 9e-08
3tub_A293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 1e-07
3vf8_A 299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 1e-07
3q6u_A 308 Structure Of The Apo Met Receptor Kinase In The Dua 1e-07
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 1e-07
3i5n_A 309 Crystal Structure Of C-Met With Triazolopyridazine 1e-07
2rfn_A 310 X-ray Structure Of C-met With Inhibitor. Length = 3 1e-07
3lq8_A 302 Structure Of The Kinase Domain Of C-Met Bound To Xl 1e-07
3f66_A 298 Human C-Met Kinase In Complex With Quinoxaline Inhi 1e-07
4fl3_A635 Structural And Biophysical Characterization Of The 1e-07
4fl2_A636 Structural And Biophysical Characterization Of The 1e-07
2wgj_A 306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 1e-07
2jc6_A 334 Crystal Structure Of Human Calmodulin-Dependent Pro 1e-07
1xba_A 291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 1e-07
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 1e-07
3emg_A291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 1e-07
1rjb_A 344 Crystal Structure Of Flt3 Length = 344 1e-07
3ekk_A 307 Insulin Receptor Kinase Complexed With An Inhibitor 1e-07
4f4p_A273 Syk In Complex With Ligand Lasw836 Length = 273 1e-07
1p14_A 306 Crystal Structure Of A Catalytic-Loop Mutant Of The 1e-07
3srv_A277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 1e-07
3q4z_A 306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 1e-07
4dfl_A274 Crystal Structure Of Spleen Tyrosine Kinase Complex 1e-07
3h4j_B 336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 1e-07
3srv_B277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 1e-07
2r5t_A 373 Crystal Structure Of Inactive Serum And Glucocortic 2e-07
2p55_A 333 X-Ray Structure Of The Human Mitogen-Activated Prot 2e-07
1s9j_A 341 X-Ray Structure Of The Human Mitogen-Activated Prot 2e-07
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 2e-07
3orn_A 307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 2e-07
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-07
2y4i_C 395 Ksr2-Mek1 Heterodimer Length = 395 2e-07
3mbl_A 328 Crystal Structure Of The Human Mitogen-Activated Pr 2e-07
3dv3_A 322 Mek1 With Pf-04622664 Bound Length = 322 2e-07
4an2_A 301 Crystal Structures Of Human Mek1 With Carboxamide-B 2e-07
3eqc_A 360 X-Ray Structure Of The Human Mitogen-Activated Prot 2e-07
3sls_A 304 Crystal Structure Of Human Mek-1 Kinase In Complex 2e-07
3c1x_A 373 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-07
2wqm_A 310 Structure Of Apo Human Nek7 Length = 310 2e-07
3mtl_A 324 Crystal Structure Of The Pctaire1 Kinase In Complex 2e-07
4azf_A 417 Human Dyrk2 In Complex With Leucettine L41 Length = 3e-07
1r0p_A 312 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-07
3qti_A 314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 3e-07
3kvw_A 429 Crystal Structure Of Dual-Specificity Tyrosine Phos 3e-07
3a4p_A 319 Human C-Met Kinase Domain Complexed With 6-Benzylox 3e-07
3cth_A 314 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-07
3dkg_A 317 Sgx Clone 5698a109kfg1h1 Length = 317 3e-07
3dkc_A 317 Sgx Clone 5698a65kfg1h1 Length = 317 3e-07
3k2l_A 429 Crystal Structure Of Dual-Specificity Tyrosine Phos 3e-07
3niz_A 311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 3e-07
1zws_A 288 Crystal Structure Of The Catalytic Domain Of Human 3e-07
2qkr_A 313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 3e-07
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 3e-07
1wmk_A 321 Human Death-Associated Kinase Drp-1, Mutant S308d D 3e-07
4apc_A 350 Crystal Structure Of Human Nima-Related Kinase 1 (N 3e-07
2a2a_A 321 High-resolution Crystallographic Analysis Of The Au 3e-07
1z9x_A 321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 3e-07
2a27_A 321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 4e-07
3pls_A 298 Ron In Complex With Ligand Amp-Pnp Length = 298 4e-07
2ac3_A 316 Structure Of Human Mnk2 Kinase Domain Length = 316 4e-07
2z7q_A 321 Crystal Structure Of The N-Terminal Kinase Domain O 4e-07
1v0b_A 288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 4e-07
2ac5_A 316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 4e-07
1v0o_A 288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 4e-07
4agu_A 311 Crystal Structure Of The Human Cdkl1 Kinase Domain 4e-07
1ob3_A 288 Structure Of P. Falciparum Pfpk5 Length = 288 4e-07
3eta_A 317 Kinase Domain Of Insulin Receptor Complexed With A 4e-07
1ua2_A 346 Crystal Structure Of Human Cdk7 Length = 346 4e-07
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 5e-07
3q4t_A 322 Crystal Structure Of Activin Receptor Type-Iia (Acv 5e-07
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 5e-07
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 5e-07
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 5e-07
1h4l_A 292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 6e-07
2qlu_A 314 Crystal Structure Of Activin Receptor Type Ii Kinas 6e-07
1ung_A 292 Structural Mechanism For The Inhibition Of Cdk5-P25 6e-07
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 6e-07
3zgw_A 347 Crystal Structure Of Maternal Embryonic Leucine Zip 6e-07
1fot_A 318 Structure Of The Unliganded Camp-Dependent Protein 6e-07
2ya9_A 361 Crystal Structure Of The Autoinhibited Form Of Mous 6e-07
3bhy_A 283 Crystal Structure Of Human Death Associated Protein 6e-07
2j90_A 304 Crystal Structure Of Human Zip Kinase In Complex Wi 7e-07
1s9i_A 354 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-07
4fsy_A 279 Crystal Structure Of The Chk1 Length = 279 9e-07
2ydj_A 276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 9e-07
4fsz_A 279 Crystal Structure Of The Chk1 Length = 279 9e-07
2q0n_A 301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 9e-07
2hog_A 322 Crystal Structure Of Chek1 In Complex With Inhibito 9e-07
2cdz_A 303 Crystal Structure Of The Human P21-Activated Kinase 9e-07
2x4z_A 296 Crystal Structure Of The Human P21-Activated Kinase 9e-07
2r0u_A 323 Crystal Structure Of Chek1 In Complex With Inhibito 1e-06
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 1e-06
2wtv_A 285 Aurora-A Inhibitor Structure Length = 285 1e-06
2bva_A 292 Crystal Structure Of The Human P21-Activated Kinase 1e-06
2wtw_A 285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 1e-06
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 1e-06
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-06
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 1e-06
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 1e-06
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 1e-06
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 1e-06
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 1e-06
3qbn_A 281 Structure Of Human Aurora A In Complex With A Diami 1e-06
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 1e-06
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 1e-06
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 1e-06
2xng_A 283 Structure Of Aurora-A Bound To A Selective Imidazop 1e-06
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 1e-06
2br1_A 297 Structure-Based Design Of Novel Chk1 Inhibitors: In 1e-06
1ia8_A 289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 1e-06
2xru_A 280 Aurora-A T288e Complexed With Pha-828300 Length = 2 1e-06
2x6d_A 285 Aurora-A Bound To An Inhibitor Length = 285 1e-06
2dwb_A 285 Aurora-A Kinase Complexed With Amppnp Length = 285 1e-06
2j50_A 280 Structure Of Aurora-2 In Complex With Pha-739358 Le 1e-06
1zlt_A 295 Crystal Structure Of Chk1 Complexed With A Hymenald 1e-06
3lau_A 287 Crystal Structure Of Aurora2 Kinase In Complex With 1e-06
1ol6_A 282 Structure Of Unphosphorylated D274n Mutant Of Auror 1e-06
1ol5_A 282 Structure Of Aurora-A 122-403, Phosphorylated On Th 1e-06
3nrm_A 283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 1e-06
1cm8_A 367 Phosphorylated Map Kinase P38-Gamma Length = 367 1e-06
3unz_A 279 Aurora A In Complex With Rpm1679 Length = 279 1e-06
3fdn_A 279 Structure-Based Drug Design Of Novel Aurora Kinase 1e-06
2j4z_A 306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-06
1phk_A 298 Two Structures Of The Catalytic Domain Of Phosphory 1e-06
4fsw_A 279 Crystal Structure Of The Chk1 Length = 279 1e-06
3uc3_A 361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 1e-06
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 1e-06
2bmc_A 306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 1e-06
4fie_A 423 Full-Length Human Pak4 Length = 423 1e-06
2c6e_A 283 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-06
4fst_A269 Crystal Structure Of The Chk1 Length = 269 1e-06
4fsn_A 278 Crystal Structure Of The Chk1 Length = 278 1e-06
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 1e-06
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-06
4fsm_A 279 Crystal Structure Of The Chk1 Length = 279 1e-06
1ql6_A 298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-06
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 1e-06
4ft3_A 279 Crystal Structure Of The Chk1 Length = 279 1e-06
2x8e_A 276 Discovery Of A Novel Class Of Triazolones As Checkp 1e-06
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 1e-06
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 1e-06
3ot3_A 273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 1e-06
4fg7_A 293 Crystal Structure Of Human Calcium/calmodulin-depen 1e-06
1muo_A 297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 1e-06
4fsu_A 279 Crystal Structure Of The Chk1 Length = 279 1e-06
4fif_A 346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 1e-06
1luf_A 343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 2e-06
2phk_A 277 The Crystal Structure Of A Phosphorylase Kinase Pep 2e-06
3gbz_A 329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 2e-06
4fg8_A 315 Crystal Structure Of Human Calcium/calmodulin-depen 2e-06
4fg9_A 320 Crystal Structure Of Human Calcium/calmodulin-depen 2e-06
3g2f_A 336 Crystal Structure Of The Kinase Domain Of Bone Morp 2e-06
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 2e-06
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 2e-06
3f69_A 311 Crystal Structure Of The Mycobacterium Tuberculosis 2e-06
1zy4_A 303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 3e-06
3g51_A 325 Structural Diversity Of The Active Conformation Of 3e-06
3ujg_A 361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 3e-06
3zut_A 362 The Structure Of Ost1 (D160a) Kinase Length = 362 3e-06
3udb_A 317 Crystal Structure Of Snrk2.6 Length = 317 3e-06
3zuu_A 362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 3e-06
4eut_A 396 Structure Of Bx-795 Complexed With Unphosphorylated 3e-06
4el9_A 305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 3e-06
3ubd_A 304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 3e-06
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 3e-06
3ll6_A 337 Crystal Structure Of The Human Cyclin G Associated 3e-06
3orm_A 311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 4e-06
4euu_A 319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 4e-06
1mru_A 311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 4e-06
3f61_A 311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 4e-06
2qr8_A 342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 4e-06
2bfy_A 284 Complex Of Aurora-B With Incenp And Hesperidin. Len 4e-06
3ori_A 311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 4e-06
2bfx_B 284 Mechanism Of Aurora-B Activation By Incenp And Inhi 4e-06
2vrx_A 285 Structure Of Aurora B Kinase In Complex With Zm4474 5e-06
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 5e-06
2jam_A 304 Crystal Structure Of Human Calmodulin-Dependent Pro 5e-06
1a06_A 332 Calmodulin-Dependent Protein Kinase From Rat Length 6e-06
2qg5_A 294 Cryptosporidium Parvum Calcium Dependent Protein Ki 6e-06
3f3z_A 277 Crystal Structure Of Cryptosporidium Parvum Calcium 6e-06
3mn3_A 271 An Inhibited Conformation For The Protein Kinase Do 7e-06
4eqm_A 294 Structural Analysis Of Staphylococcus Aureus Serine 7e-06
2x4f_A 373 The Crystal Structure Of The Human Myosin Light Cha 7e-06
3dae_A 283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 8e-06
3gc9_A 370 The Structure Of P38beta C119s, C162s In Complex Wi 8e-06
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 8e-06
2ycr_A 323 Crystal Structure Of Checkpoint Kinase 2 In Complex 8e-06
2xk9_A 322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 8e-06
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 8e-06
2w0j_A 323 Crystal Structure Of Chk2 In Complex With Nsc 10955 8e-06
1h1w_A 289 High Resolution Crystal Structure Of The Human Pdk1 8e-06
1koa_A 491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 8e-06
1z5m_A 286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 8e-06
1uu9_A 286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 9e-06
2ycf_A 322 Crystal Structure Of Checkpoint Kinase 2 In Complex 9e-06
3nun_A 292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 9e-06
3nax_A 311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 9e-06
4a07_A 311 Human Pdk1 Kinase Domain In Complex With Allosteric 9e-06
3nus_A 286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 9e-06
2biy_A 310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 9e-06
3iop_A 312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 9e-06
3sc1_A 311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 9e-06
3nay_A 311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 9e-06
3rwp_A 311 Discovery Of A Novel, Potent And Selective Inhibito 9e-06
2xch_A 309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 9e-06
2r7b_A 312 Crystal Structure Of The Phosphoinositide-Dependent 9e-06
1uu3_A 310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 9e-06
3qc4_A 314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 9e-06
2xck_A 309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 9e-06
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 1e-05
3h9o_A 311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 1e-05
2cn5_A 329 Crystal Structure Of Human Chk2 In Complex With Adp 1e-05
3pwy_A 311 Crystal Structure Of An Extender (Spd28345)-Modifie 1e-05
3hrc_A 311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 1e-05
3orx_A 316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 1e-05
3gc8_A 370 The Structure Of P38beta C162s In Complex With A Di 1e-05
3c4x_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 1e-05
2wnt_A 330 Crystal Structure Of The Human Ribosomal Protein S6 1e-05
3c4w_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 1e-05
3qc9_A 543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 1e-05
3t8o_A 543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 1e-05
3gp0_A 348 Crystal Structure Of Human Mitogen Activated Protei 1e-05
3rny_A 346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 1e-05
2qr7_A 342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 2e-05
2hw6_A 307 Crystal Structure Of Mnk1 Catalytic Domain Length = 2e-05
3iw4_A 360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 2e-05
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 2e-05
3p23_A 432 Crystal Structure Of The Human Kinase And Rnase Dom 2e-05
3i6w_A 443 Structure And Activation Mechanism Of The Chk2 Dna- 3e-05
3i6u_A 419 Structure And Activation Mechanism Of The Chk2 Dna- 3e-05
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 3e-05
1zyc_A 303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 3e-05
3uc4_A 362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 3e-05
2w4o_A 349 Crystal Structure Of Human Camk4 In Complex With 4- 3e-05
3uiu_A 306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 5e-05
4g3d_A 371 Crystal Structure Of Human Nf-kappab Inducing Kinas 6e-05
4dn5_A 356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 6e-05
1bi8_A 326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 6e-05
3nyn_A 576 Crystal Structure Of G Protein-Coupled Receptor Kin 6e-05
1jow_B 308 Crystal Structure Of A Complex Of Human Cdk6 And A 6e-05
2acx_A 576 Crystal Structure Of G Protein Coupled Receptor Kin 6e-05
3coi_A 353 Crystal Structure Of P38delta Kinase Length = 353 7e-05
3nup_A 307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 7e-05
3d5v_A 317 Crystal Structure Of An Activated (Thr->asp) Polo-L 7e-05
3db6_A 301 Crystal Structure Of An Activated (Thr->asp) Polo-L 7e-05
1p4f_A 293 Death Associated Protein Kinase Catalytic Domain Wi 7e-05
3aln_A 327 Crystal Structure Of Human Non-Phosphorylated Mkk4 7e-05
3gu8_A 295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 7e-05
3d5w_A 317 Crystal Structure Of A Phosphorylated Polo-Like Kin 7e-05
1ig1_A 294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 7e-05
3gu4_A 295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 7e-05
3d5u_A 317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 7e-05
4b99_A 398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 7e-05
2wel_A 327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 7e-05
3f5u_A 295 Crystal Structure Of The Death Associated Protein K 8e-05
4ic7_A 442 Crystal Structure Of The Erk5 Kinase Domain In Comp 8e-05
2v7o_A 336 Crystal Structure Of Human Calcium-Calmodulin-Depen 8e-05
3dfc_B 295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 8e-05
2buj_A 317 Crystal Structure Of The Human Serine-Threonine Kin 8e-05
2vn9_A 301 Crystal Structure Of Human Calcium Calmodulin Depen 8e-05
2yak_A 285 Structure Of Death-Associated Protein Kinase 1 (Dap 9e-05
4fr4_A 384 Crystal Structure Of Human SerineTHREONINE-Protein 9e-05
2y0a_A 326 Structure Of Dapk1 Construct Residues 1-304 Length 1e-04
1pme_A 380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 1e-04
2xzs_A 312 Death Associated Protein Kinase 1 Residues 1-312 Le 1e-04
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 1e-04
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 1e-04
2x0g_A 334 X-ray Structure Of A Dap-kinase Calmodulin Complex 1e-04
2w4k_A 302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 1e-04
2xuu_A 334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 1e-04
2w96_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-04
3lm0_A 327 Crystal Structure Of Human SerineTHREONINE KINASE 1 1e-04
2w99_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-04
2w9f_B 306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-04
1zxe_A 303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 2e-04
4exu_A 371 Mapk13, Inactive Form Length = 371 2e-04
2pml_X 348 Crystal Structure Of Pfpk7 In Complex With An Atp A 2e-04
4g3c_A 352 Crystal Structure Of Apo Murine Nf-kappab Inducing 2e-04
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 2e-04
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 2e-04
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 2e-04
2z2w_A 285 Humand Wee1 Kinase Complexed With Inhibitor Pf03357 2e-04
4g3g_A 350 Crystal Structure Of Murine Nf-kappab Inducing Kina 2e-04
4g3f_A 336 Crystal Structure Of Murine Nf-kappab Inducing Kina 2e-04
3gcp_A 360 Human P38 Map Kinase In Complex With Sb203580 Lengt 2e-04
2in6_A 287 Wee1 Kinase Complex With Inhibitor Pd311839 Length 2e-04
1kob_A 387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 2e-04
3bi6_A 287 Wee1 Kinase Complex With Inhibitor Pd352396 Length 3e-04
3vhe_A 359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 3e-04
1y6a_A 366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 3e-04
4af3_A 292 Human Aurora B Kinase In Complex With Incenp And Vx 3e-04
1x8b_A 289 Structure Of Human Wee1a Kinase: Kinase Domain Comp 3e-04
3vhk_A 368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-04
3vid_A 356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 3e-04
3fme_A 290 Crystal Structure Of Human Mitogen-Activated Protei 3e-04
3d83_A 360 Crystal Structure Of P38 Kinase In Complex With A B 3e-04
3d7z_A 360 Crystal Structure Of P38 Kinase In Complex With A B 3e-04
2baq_A 365 P38alpha Bound To Ro3201195 Length = 365 3e-04
3vn9_A 340 Rifined Crystal Structure Of Non-Phosphorylated Map 3e-04
2wtk_B 373 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 4e-04
3gni_B 389 Structure Of Strad And Mo25 Length = 389 4e-04
1ian_A 366 Human P38 Map Kinase Inhibitor Complex Length = 366 4e-04
3zsg_A 362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 5e-04
1bmk_A 379 The Complex Structure Of The Map Kinase P38SB218655 5e-04
3fi4_A 372 P38 Kinase Crystal Structure In Complex With Ro4499 5e-04
2oza_B 366 Structure Of P38alpha Complex Length = 366 5e-04
3py3_A 380 Crystal Structure Of Phosphorylated P38alpha Map Ki 5e-04
3dt1_A 383 P38 Complexed With A Quinazoline Inhibitor Length = 5e-04
1bl6_A 379 The Complex Structure Of The Map Kinase P38SB216995 5e-04
3tg1_A 380 Crystal Structure Of P38alpha In Complex With A Map 5e-04
2fst_X 367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 5e-04
3nnu_A 354 Crystal Structure Of P38 Alpha In Complex With Dp13 5e-04
3mh2_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 5e-04
2fsl_X 367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 5e-04
3gi3_A 360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 5e-04
3mh1_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 5e-04
3ody_X 360 Crystal Structure Of P38alpha Y323q Active Mutant L 5e-04
3mh3_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 5e-04
2gtm_A 348 Mutated Mouse P38 Map Kinase Domain In Complex With 5e-04
1ove_A 366 The Structure Of P38 Alpha In Complex With A Dihydr 5e-04
1lew_A 360 Crystal Structure Of Map Kinase P38 Complexed To Th 5e-04
3k3j_A 362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 5e-04
3o8p_A 360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 5e-04
2baj_A 365 P38alpha Bound To Pyrazolourea Length = 365 5e-04
1ywr_A 360 Crystal Structure Analysis Of Inactive P38 Kinase D 5e-04
3s3i_A 349 P38 Kinase Crystal Structure In Complex With Small 5e-04
3nnx_A 354 Crystal Structure Of Phosphorylated P38 Alpha In Co 5e-04
3mh0_A 360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 5e-04
3hrb_A 359 P38 Kinase Crystal Structure In Complex With Small 5e-04
3gcu_A 360 Human P38 Map Kinase In Complex With Rl48 Length = 5e-04
3hvc_A 362 Crystal Structure Of Human P38alpha Map Kinase Leng 5e-04
2bal_A 365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 5e-04
1zzl_A 351 Crystal Structure Of P38 With Triazolopyridine Leng 5e-04
1oz1_A 372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 5e-04
3od6_X 360 Crystal Structure Of P38alpha Y323t Active Mutant L 5e-04
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 5e-04
2wtk_C 305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 5e-04
3hec_A 348 P38 In Complex With Imatinib Length = 348 5e-04
2fso_X 367 Mitogen Activated Protein Kinase P38alpha (D176a) A 5e-04
2gfs_A 372 P38 Kinase Crystal Structure In Complex With Ro3201 5e-04
1di9_A 360 The Structure Of P38 Mitogen-Activated Protein Kina 5e-04
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 5e-04
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 5e-04
3p4k_A 370 The Third Conformation Of P38a Map Kinase Observed 5e-04
1yw2_A 360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 5e-04
3odz_X 360 Crystal Structure Of P38alpha Y323r Active Mutant L 5e-04
3kq7_A 380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 5e-04
4e5a_X 360 The W197a Mutant Of P38a Map Kinase Length = 360 5e-04
3oef_X 360 Crystal Structure Of Y323f Inactive Mutant Of P38al 5e-04
3k3i_A 350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 5e-04
1m7q_A 366 Crystal Structure Of P38 Map Kinase In Complex With 5e-04
2y8o_A 362 Crystal Structure Of Human P38alpha Complexed With 6e-04
2npq_A 367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 6e-04
2ghl_A 348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 6e-04
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 6e-04
2lgc_A 359 Joint Nmr And X-Ray Refinement Reveals The Structur 6e-04
3mpt_A 371 Crystal Structure Of P38 Kinase In Complex With A P 6e-04
3e92_A 371 Crystal Structure Of P38 Kinase In Complex With A B 6e-04
4ewq_A 383 Human P38 Alpha Mapk In Complex With A Pyridazine B 6e-04
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 6e-04
1xjd_A 345 Crystal Structure Of Pkc-Theta Complexed With Staur 6e-04
3enh_A540 Crystal Structure Of Cgi121BUD32KAE1 COMPLEX Length 7e-04
3fi3_A 364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 7e-04
2vwb_A535 Structure Of The Archaeal Kae1-Bud32 Fusion Protein 7e-04
2i0e_A 353 Structure Of Catalytic Domain Of Human Protein Kina 8e-04
3vuk_A 370 Crystal Structure Of A Cysteine-deficient Mutant M5 8e-04
3vul_A 370 Crystal Structure Of A Cysteine-deficient Mutant M1 8e-04
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 8e-04
3oht_A 389 Crystal Structure Of Salmo Salar P38alpha Length = 8e-04
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 9e-04
3kk8_A 284 Camkii Substrate Complex A Length = 284 9e-04
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure

Iteration: 1

Score = 114 bits (285), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 60/136 (44%), Positives = 89/136 (65%), Gaps = 4/136 (2%) Query: 247 LKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQ 306 L + KI +GS+ +++ + DVA+K+L + + EF +EV IM+++RH N+V Sbjct: 39 LNIKEKIGAGSFGTVHRAEWHGSDVAVKILMEQDFHAERVNEFLREVAIMKRLRHPNIVL 98 Query: 307 FIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLP--LLLRVAIDVSKGMNYLHRNN- 363 F+GA T+PP L IVTE++S GS+Y LHK +L L +A DV+KGMNYLH N Sbjct: 99 FMGAVTQPPNLSIVTEYLSRGSLYRLLHKSGAREQLDERRRLSMAYDVAKGMNYLHNRNP 158 Query: 364 -IIHRDLKAANLLMNE 378 I+HRDLK+ NLL+++ Sbjct: 159 PIVHRDLKSPNLLVDK 174
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|1RW8|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Atp Site Inhibitor Length = 301 Back     alignment and structure
>pdb|1PY5|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Inhibitor Length = 326 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|1B6C|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of The Type I Tgf-Beta Receptor In Complex With Fkbp12 Length = 342 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|2WOT|A Chain A, Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl)-3- Pyridyl)oxy)-N-(3,4,5-Trimethoxyphenyl)pyridin-2-Amine Length = 306 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|1VJY|A Chain A, Crystal Structure Of A Naphthyridine Inhibitor Of Human Tgf- Beta Type I Receptor Length = 303 Back     alignment and structure
>pdb|3TZM|A Chain A, Tgf-Beta Receptor Type 1 In Complex With Sb431542 Length = 309 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|3MTF|A Chain A, Crystal Structure Of The Acvr1 Kinase In Complex With A 2- Aminopyridine Inhibitor Length = 301 Back     alignment and structure
>pdb|4DYM|A Chain A, Crystal Structure Of The Acvr1 Kinase Domain In Complex With The Imidazo[1,2-B]pyridazine Inhibitor K00135 Length = 301 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|3H9R|A Chain A, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 330 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|3MDY|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of The Bone Morp Protein Receptor Type-1b (Bmpr1b) In Complex With Fkbp12 An 193189 Length = 337 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3MY0|A Chain A, Crystal Structure Of The Acvrl1 (Alk1) Kinase Domain Bound To Ldn- 193189 Length = 305 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|3KMU|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Apo) Length = 271 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4FVP|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain (Apo Form) Length = 289 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|4FVR|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain Mutant V617f (Mg- Atp-Bound Form) Length = 289 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|2QLU|A Chain A, Crystal Structure Of Activin Receptor Type Ii Kinase Domain From Human Length = 314 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|3G2F|A Chain A, Crystal Structure Of The Kinase Domain Of Bone Morphogenetic Protein Receptor Type Ii (Bmpr2) At 2.35 A Resolution Length = 336 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|2Z2W|A Chain A, Humand Wee1 Kinase Complexed With Inhibitor Pf0335770 Length = 285 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|2IN6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd311839 Length = 287 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|3BI6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd352396 Length = 287 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|1X8B|A Chain A, Structure Of Human Wee1a Kinase: Kinase Domain Complexed With Inhibitor Pd0407824 Length = 289 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|2WTK|B Chain B, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 373 Back     alignment and structure
>pdb|3GNI|B Chain B, Structure Of Strad And Mo25 Length = 389 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|3ENH|A Chain A, Crystal Structure Of Cgi121BUD32KAE1 COMPLEX Length = 540 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|2VWB|A Chain A, Structure Of The Archaeal Kae1-Bud32 Fusion Protein Mj1130: A Model For The Eukaryotic Ekc-Keops Subcomplex Involved In Transcription And Telomere Homeostasis. Length = 535 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query411
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 4e-70
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 5e-69
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 9e-69
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 6e-68
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 6e-66
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-63
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-62
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 2e-60
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-56
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 1e-50
3soc_A 322 Activin receptor type-2A; structural genomics cons 7e-48
3q4u_A 301 Activin receptor type-1; structural genomics conso 2e-47
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 9e-47
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 4e-46
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 2e-44
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-43
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 4e-43
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-42
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-42
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-42
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 4e-42
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 4e-42
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 8e-42
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 2e-41
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-41
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 3e-41
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 3e-41
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-41
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 4e-41
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 8e-41
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 1e-39
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 1e-39
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-39
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 2e-39
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 5e-39
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 6e-39
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-38
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 3e-38
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 3e-38
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 4e-38
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 5e-38
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 6e-38
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-37
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 3e-37
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 8e-37
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 1e-36
3pls_A 298 Macrophage-stimulating protein receptor; protein k 4e-36
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 1e-35
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 2e-35
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 4e-35
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 4e-35
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-34
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 3e-34
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 6e-34
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 1e-33
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 2e-33
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 8e-33
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 9e-33
4aoj_A 329 High affinity nerve growth factor receptor; transf 1e-32
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 4e-32
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 7e-32
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 7e-32
2xir_A316 Vascular endothelial growth factor receptor 2; ang 7e-31
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 9e-31
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 1e-30
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 3e-30
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 4e-30
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 1e-29
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 2e-28
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 3e-27
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 5e-27
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-26
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 3e-26
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-25
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-25
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 6e-25
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 7e-25
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 9e-25
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-24
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 3e-24
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 3e-24
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 4e-24
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 4e-24
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 1e-23
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 1e-23
3aln_A 327 Dual specificity mitogen-activated protein kinase; 1e-23
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 2e-23
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 7e-23
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 8e-23
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 8e-23
3fme_A 290 Dual specificity mitogen-activated protein kinase; 1e-22
3an0_A 340 Dual specificity mitogen-activated protein kinase; 1e-22
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 1e-22
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-22
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 2e-22
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 3e-22
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 3e-22
2dyl_A 318 Dual specificity mitogen-activated protein kinase 3e-22
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 7e-22
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 7e-22
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 8e-22
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-20
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 4e-20
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 4e-20
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 4e-20
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 5e-20
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 5e-20
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 5e-20
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 7e-20
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 2e-19
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 7e-19
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 9e-19
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 2e-18
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 2e-18
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-18
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 4e-18
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 1e-17
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 1e-17
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-17
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 3e-17
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 7e-17
2eue_A275 Carbon catabolite derepressing protein kinase; kin 1e-16
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 2e-16
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-16
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 4e-16
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 9e-16
3niz_A 311 Rhodanese family protein; structural genomics, str 2e-15
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 2e-15
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-15
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 3e-15
3o0g_A 292 Cell division protein kinase 5; kinase activator c 4e-15
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 5e-15
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 5e-15
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 5e-15
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 6e-15
3bhy_A 283 Death-associated protein kinase 3; death associate 7e-15
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 8e-15
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 8e-15
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 9e-15
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 9e-15
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 1e-14
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-14
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-14
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 1e-14
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 1e-14
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-06
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-14
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 2e-14
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 2e-14
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-14
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 3e-14
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 3e-14
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 3e-14
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 4e-14
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 5e-14
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 5e-14
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 6e-14
3uqc_A286 Probable conserved transmembrane protein; structur 7e-14
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 7e-14
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 8e-14
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 8e-14
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 8e-14
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 1e-13
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 1e-13
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 1e-13
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 1e-13
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 1e-13
3ork_A 311 Serine/threonine protein kinase; structural genomi 2e-13
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 2e-13
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 4e-13
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 5e-13
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 5e-13
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 1e-12
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-12
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 3e-12
1uu3_A 310 HPDK1, 3-phosphoinositide dependent protein kinase 3e-12
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 5e-12
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 7e-12
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 2e-11
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 3e-11
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 3e-11
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 3e-11
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-11
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 4e-11
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 4e-11
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 6e-11
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 7e-11
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 9e-11
3g51_A 325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 1e-10
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-10
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-10
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 3e-10
3rp9_A 458 Mitogen-activated protein kinase; structural genom 3e-10
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 3e-10
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 3e-10
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 4e-10
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 5e-10
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 5e-10
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 7e-10
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 8e-10
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 1e-09
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 1e-09
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 1e-09
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 2e-09
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 2e-09
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-09
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 4e-09
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 4e-09
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 4e-09
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 6e-09
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 6e-09
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 9e-09
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 1e-08
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 1e-08
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 1e-08
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 1e-08
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 1e-08
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 1e-08
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 2e-08
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 2e-08
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 3e-08
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 4e-08
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 5e-08
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 6e-08
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 6e-08
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 7e-08
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 8e-08
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 9e-08
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 2e-07
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 3e-07
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 4e-07
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 5e-07
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 7e-07
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 2e-06
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 2e-06
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 2e-05
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
 Score =  222 bits (568), Expect = 4e-70
 Identities = 66/175 (37%), Positives = 103/175 (58%), Gaps = 5/175 (2%)

Query: 212 HHHVVYPVGEQEQSGINHVNI-PAEGIDVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQD 270
           HHH  +P+ + +     ++    A   D  +I    L  + KI +GS+  +++  +   D
Sbjct: 3   HHHHHHPMSDYDIPTTENLYFQGAMDGDDMDIPWCDLNIKEKIGAGSFGTVHRAEWHGSD 62

Query: 271 VAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIY 330
           VA+K+L  +  +     EF +EV IM+++RH N+V F+GA T+PP L IVTE++S GS+Y
Sbjct: 63  VAVKILMEQDFHAERVNEFLREVAIMKRLRHPNIVLFMGAVTQPPNLSIVTEYLSRGSLY 122

Query: 331 DYLHKQKCGLKLPL--LLRVAIDVSKGMNYLHRNN--IIHRDLKAANLLMNENGV 381
             LHK     +L     L +A DV+KGMNYLH  N  I+HR+LK+ NLL+++   
Sbjct: 123 RLLHKSGAREQLDERRRLSMAYDVAKGMNYLHNRNPPIVHRNLKSPNLLVDKKYT 177


>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query411
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4aoj_A 329 High affinity nerve growth factor receptor; transf 100.0
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 100.0
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 100.0
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 100.0
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.98
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.98
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.98
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.97
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.97
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.97
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.97
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.97
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.97
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.97
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.96
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.96
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.96
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.96
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.96
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.96
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.96
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.96
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.96
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.96
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.96
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.96
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.96
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.95
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.95
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.95
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.95
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.95
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.95
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.95
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.95
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.95
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.95
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.95
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.95
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.95
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.95
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.95
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.95
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.95
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.95
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.95
3niz_A 311 Rhodanese family protein; structural genomics, str 99.95
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.95
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.95
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.95
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.95
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.95
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.95
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.95
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.95
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.95
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.95
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.95
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.95
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.95
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.95
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.95
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.95
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.95
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.95
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.95
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.95
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.95
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.95
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.95
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.95
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.95
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.95
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.95
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.95
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.95
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.95
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.95
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.95
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.95
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.95
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.95
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.94
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.94
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.94
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.94
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.94
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.94
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.94
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.94
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.94
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.94
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.94
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.94
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.94
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.94
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.94
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.94
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.94
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.94
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.94
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.94
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.94
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.94
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.94
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.94
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.94
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.94
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.94
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.94
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.94
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.94
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.94
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.94
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.94
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.94
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.94
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.94
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.94
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.94
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.94
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.94
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.94
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.94
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.94
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.94
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.94
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.94
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.94
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.94
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.94
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.94
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.94
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.94
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.94
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.94
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.94
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.94
3bhy_A 283 Death-associated protein kinase 3; death associate 99.94
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.94
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.94
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.94
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.94
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.94
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.94
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.94
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.94
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.94
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.94
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.94
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.94
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.94
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.93
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.93
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.93
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.93
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.93
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.93
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.93
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.93
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.93
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.93
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.93
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.93
3uqc_A286 Probable conserved transmembrane protein; structur 99.93
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.93
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.93
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.93
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.93
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.93
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.93
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.93
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.93
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.93
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.93
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.93
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.93
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.93
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.93
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.93
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.93
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.93
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.93
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.93
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.93
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.93
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.93
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.93
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.93
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.93
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.93
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.93
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.93
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.93
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.93
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.93
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.93
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.93
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.93
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.93
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.93
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.93
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.93
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.93
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.93
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.93
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.93
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.93
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.93
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.93
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.92
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.92
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.92
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.92
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.92
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.92
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.92
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.92
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.92
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.92
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.92
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.92
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.92
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.92
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.92
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.92
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.92
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.92
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.92
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.91
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.91
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.91
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.91
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.91
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.91
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.91
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.9
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.9
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.89
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.89
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.88
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 99.87
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.84
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.72
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.34
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.14
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 99.12
3r70_A320 Aminoglycoside phosphotransferase; structural geno 98.66
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.54
3tdw_A 306 Gentamicin resistance protein; kinase, phosphoryl 98.42
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.34
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.24
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.18
3ats_A 357 Putative uncharacterized protein; hypothetical pro 98.09
2q83_A 346 YTAA protein; 2635576, structural genomics, joint 98.05
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 98.0
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 97.52
2pyw_A 420 Uncharacterized protein; 5-methylthioribose kinase 97.52
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.18
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 97.09
3csv_A 333 Aminoglycoside phosphotransferase; YP_614837.1, ph 97.08
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 96.86
3dxq_A 301 Choline/ethanolamine kinase family protein; NP_106 96.8
1nw1_A 429 Choline kinase (49.2 KD); phospholipid synthesis, 96.49
1zyl_A 328 Hypothetical protein YIHE; putative protein kinase 96.48
3c5i_A 369 Choline kinase; choline, kinase, malaria, transfer 96.35
3feg_A 379 Choline/ethanolamine kinase; non-protein kinase, c 95.82
2qg7_A 458 Ethanolamine kinase PV091845; malaria, SGC, struct 95.36
3i1a_A 339 Spectinomycin phosphotransferase; protein kinase, 95.07
3f2s_A 401 CK, chetk-alpha, choline kinase alpha; non-protein 94.47
1u8s_A192 Glycine cleavage system transcriptional repressor, 94.07
2nyi_A195 Unknown protein; protein structure initiative, PSI 93.78
3mes_A 424 Choline kinase; malaria, structural genomics, stru 92.76
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 90.38
3g15_A 401 CK, chetk-alpha, choline kinase alpha; non-protein 88.69
3maz_A125 Signal-transducing adaptor protein 1; modular doma 87.24
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 86.56
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 85.77
2dly_A121 FYN-related kinase; BRK family kinase, structural 85.6
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 84.9
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 81.97
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 81.31
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 80.79
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 80.22
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=4.1e-37  Score=302.70  Aligned_cols=156  Identities=35%  Similarity=0.598  Sum_probs=142.5

Q ss_pred             CcceeecCCCeEEEEEEeecCceEEEEEEECCceEEEEEeeccccCHHHHHHHHHHHHHHhhcCCCceeEEEeeeecCCe
Q 015242          237 IDVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPR  316 (411)
Q Consensus       237 ~~~~ei~~~~~~~~~~IG~Gsfg~Vy~g~~~~~~VAIK~l~~~~~~~~~~~~~~~Ei~iL~~l~HpNIV~l~g~~~~~~~  316 (411)
                      .+.|||+.+++++.++||+|+||.||+|++.+ .||||+++....+....+.|.+|+.+|++++|||||+++|+|.. +.
T Consensus        28 ~~~Wei~~~~l~l~~~iG~G~fG~Vy~~~~~~-~vAvK~~~~~~~~~~~~~~f~~E~~il~~l~HpNIV~l~g~~~~-~~  105 (307)
T 3omv_A           28 SYYWEIEASEVMLSTRIGSGSFGTVYKGKWHG-DVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTK-DN  105 (307)
T ss_dssp             -CCCBCCTTSCCEEEECCCCSSSEEEEEESSS-EEEEEECCCSSCCHHHHHHHHHHHHHHTTCCCTTBCCEEEEECS-SS
T ss_pred             CcCcEEcHHHeEEeeEEeeCCCcEEEEEEECC-cEEEEEEEecCCCHHHHHHHHHHHHHHHhCCCCCEeeEEEEEEC-Ce
Confidence            46799999999999999999999999998765 69999998776677778899999999999999999999999875 46


Q ss_pred             EEEEEecCCCCCHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHHHCCccccCCCCCcEEEccCCCcCCCccEEEEecCcc
Q 015242          317 LFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSI  396 (411)
Q Consensus       317 l~IV~Ey~~gGsL~~~L~~~~~~l~~~~i~~i~~qIa~gL~yLH~~gIIHRDLKp~NILld~~g~~k~~~~ikL~DFG~a  396 (411)
                      +|||||||+||+|.++|......+++..+..++.||+.||.|||+++||||||||+|||+++++      .+||+|||+|
T Consensus       106 ~~iVmEy~~gGsL~~~l~~~~~~l~~~~~~~i~~qia~gL~yLH~~~IiHRDlKp~NILl~~~~------~~Ki~DFGla  179 (307)
T 3omv_A          106 LAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL------TVKIGDFGLA  179 (307)
T ss_dssp             CEEEEECCSSCBHHHHHHTSCCCCCHHHHHHHHHHHHHHHHHHHHTTCBCSCCCSSSEEEETTE------EEEECCCSSC
T ss_pred             EEEEEEcCCCCCHHHHHhhcCCCCCHHHHHHHHHHHHHHHHHHHHCCccCCccCHHHEEECCCC------cEEEeeccCc
Confidence            8999999999999999988777899999999999999999999999999999999999999988      6999999999


Q ss_pred             cccc
Q 015242          397 STVI  400 (411)
Q Consensus       397 ~~~~  400 (411)
                      +...
T Consensus       180 ~~~~  183 (307)
T 3omv_A          180 TVKS  183 (307)
T ss_dssp             BC--
T ss_pred             eecc
Confidence            8653



>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 411
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 8e-41
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 5e-36
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-32
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-32
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 8e-32
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-31
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 7e-31
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-30
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-30
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 4e-30
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 8e-30
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 9e-30
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-29
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-29
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-29
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 7e-29
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 1e-28
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-28
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-28
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-28
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-27
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 1e-27
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-27
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 3e-27
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-27
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 7e-27
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-26
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 7e-26
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 8e-26
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 9e-26
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-25
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-25
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-25
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-24
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-24
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 7e-24
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 3e-23
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-23
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 8e-23
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 8e-23
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-22
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 4e-22
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-21
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 2e-21
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 3e-21
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-20
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 3e-20
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-20
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 6e-20
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-19
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-19
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-19
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-19
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-19
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-19
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 8e-19
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-17
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 2e-17
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-17
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-16
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-15
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 8e-11
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 3e-09
d1ygya378 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogena 3e-05
d1sc6a384 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogena 3e-05
d1y7pa277 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N 9e-04
d2pc6a277 d.58.18.6 (A:1-77) Acetolactate synthase small sub 0.003
d1u8sa186 d.58.18.5 (A:2-87) putative transcriptional repres 0.004
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  143 bits (363), Expect = 8e-41
 Identities = 53/144 (36%), Positives = 85/144 (59%), Gaps = 2/144 (1%)

Query: 238 DVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMR 297
           D WEI    +    +I SGS+  +YKG  +  DVA+K+L          + F  EV ++R
Sbjct: 1   DDWEIPDGQITVGQRIGSGSFGTVYKG-KWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLR 59

Query: 298 KVRHMNVVQFIGACTRPPRLFIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMN 357
           K RH+N++ F+G  T P  L IVT++  G S+Y +LH  +   ++  L+ +A   ++GM+
Sbjct: 60  KTRHVNILLFMGYSTAPQ-LAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMD 118

Query: 358 YLHRNNIIHRDLKAANLLMNENGV 381
           YLH  +IIHRDLK+ N+ ++E+  
Sbjct: 119 YLHAKSIIHRDLKSNNIFLHEDLT 142


>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 78 Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Length = 84 Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 77 Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Length = 77 Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query411
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 100.0
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.98
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.98
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.98
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.98
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.98
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.98
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.98
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.98
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.98
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.98
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.98
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.97
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.97
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.97
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.97
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.97
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.97
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.97
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.97
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.97
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.97
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.97
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.97
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.97
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.97
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.97
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.97
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.97
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.96
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.96
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.96
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.96
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.96
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.96
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.96
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.96
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.96
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.96
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.95
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.95
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.95
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.95
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.9
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.88
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.29
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 97.64
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.13
d1zyla1 325 RdoA {Escherichia coli [TaxId: 562]} 96.05
d1nw1a_ 395 Choline kinase {Caenorhabditis elegans [TaxId: 623 94.88
d2ppqa1 316 Homoserine kinase ThrB {Agrobacterium tumefaciens 94.57
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 92.94
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 92.27
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 91.72
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 91.2
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 91.2
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 90.72
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 87.48
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 84.84
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 83.6
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 82.26
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 81.62
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 80.34
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.3e-36  Score=290.28  Aligned_cols=155  Identities=35%  Similarity=0.612  Sum_probs=141.5

Q ss_pred             cceeecCCCeEEEEEEeecCceEEEEEEECCceEEEEEeeccccCHHHHHHHHHHHHHHhhcCCCceeEEEeeeecCCeE
Q 015242          238 DVWEIDASLLKFEHKIVSGSYCDLYKGAFFSQDVAIKVLTNEHLNENIRREFAQEVHIMRKVRHMNVVQFIGACTRPPRL  317 (411)
Q Consensus       238 ~~~ei~~~~~~~~~~IG~Gsfg~Vy~g~~~~~~VAIK~l~~~~~~~~~~~~~~~Ei~iL~~l~HpNIV~l~g~~~~~~~l  317 (411)
                      |+|||+.++|++.++||+|+||.||+|++.+ .||||+++....+....+.|.+|+.+|++++|||||+++|++.. +.+
T Consensus         1 ddwei~~~~~~~~~~lG~G~fg~Vy~~~~~~-~vAvK~~~~~~~~~~~~~~~~~E~~~l~~l~HpnIv~~~~~~~~-~~~   78 (276)
T d1uwha_           1 DDWEIPDGQITVGQRIGSGSFGTVYKGKWHG-DVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTA-PQL   78 (276)
T ss_dssp             CCCBCCTTCCCCCSEEEECSSCEEEEEESSS-EEEEEECCCSSCCTTHHHHHHHHHHHHTTCCCTTBCCEEEEECS-SSC
T ss_pred             CCcccccccEEEEEEEeeCCCcEEEEEEECC-EEEEEEEEcccCCHHHHHHHHHHHHHHHhCCCCCEeeeeEEEec-cEE
Confidence            6799999999999999999999999998765 69999998776666677899999999999999999999999865 468


Q ss_pred             EEEEecCCCCCHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHHHCCccccCCCCCcEEEccCCCcCCCccEEEEecCccc
Q 015242          318 FIVTEFMSGGSIYDYLHKQKCGLKLPLLLRVAIDVSKGMNYLHRNNIIHRDLKAANLLMNENGVRDSDIHCYLSNFLSIS  397 (411)
Q Consensus       318 ~IV~Ey~~gGsL~~~L~~~~~~l~~~~i~~i~~qIa~gL~yLH~~gIIHRDLKp~NILld~~g~~k~~~~ikL~DFG~a~  397 (411)
                      |||||||++|+|.+++...+..+++..++.++.||+.||.|||+++||||||||+|||++.++      .+||+|||+|+
T Consensus        79 ~lv~Ey~~~g~L~~~l~~~~~~~~~~~~~~i~~qi~~gl~yLH~~~ivHrDlKp~NiLl~~~~------~~Kl~DFGla~  152 (276)
T d1uwha_          79 AIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDL------TVKIGDFGLAT  152 (276)
T ss_dssp             EEEEECCCEEEHHHHHHTSCCCCCHHHHHHHHHHHHHHHHHHHHTTCCCSCCCGGGEEEETTS------SEEECCCCCSC
T ss_pred             EEEEecCCCCCHHHHHhhccCCCCHHHHHHHHHHHHHHHHHHhcCCEeccccCHHHEEEcCCC------CEEEcccccee
Confidence            999999999999999987766799999999999999999999999999999999999999988      58999999997


Q ss_pred             ccc
Q 015242          398 TVI  400 (411)
Q Consensus       398 ~~~  400 (411)
                      ...
T Consensus       153 ~~~  155 (276)
T d1uwha_         153 VKS  155 (276)
T ss_dssp             C--
T ss_pred             ecc
Confidence            654



>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure