Citrus Sinensis ID: 015254

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410
MAKSNILALFLSLLMLSAAAALDVDVTKHGAKQNADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQVKGTLKALTDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQGAVAPSECEKDDYCKKRPIVSNLSFNAITNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGRSSGVTITDSKIGTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVRECNISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSRVKLDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNPPPCIASATPSGSAIPGRRRLSFNF
ccHHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHccccccEEEEcccEEEEEEEEEEccccccEEEEEEEEEECcccccccccccccEEEEEEEEEEEEEcEEEcccccccccccccccccccccCEEEEEEEECccEEEEEEEEEccccEEEEEEcCEcEEEEEEEEEcccccccccCEEccccccEEEEEEEECccccEEEEccccCEEEEEEEEEccccccEEEEcccccccccCEEEEEEEEEEEccccCEEEEEcccccccEEEEEEEEcEEEEcccccEEEEEECcccccccccccccEEEEEEEEEEEEEEEcccccEEEEccccccCCcEEEEEEEEEEccccccccEEECccccccccCEccccccccccccccccccccEEEEcc
**KSNILALFLSLLMLSAAAALDVDVTKHGAKQNADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQVKGTLKALTDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQGAVAPSECEKDDYCKKRPIVSNLSFNAITNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGRSSGVTITDSKIGTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVRECNISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSRVKLDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNPPPC**************RRLSFN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSNILALFLSLLMLSAAAALDVDVTKHGAKQNADISQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIELQVKGTLKALTDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQGAVAPSECEKDDYCKKRPIVSNLSFNAITNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGIHVGRSSGVTITDSKIGTGDDCISIGDGTQQMEINKIDCGPGHGISVGSLGKYQNEQPVVGIRVRECNISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPHNQCNAKVPSRVKLDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNPPPCIASATPSGSAIPGRRRLSFNF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polygalacturonase May function in depolymerizing pectin during pollen development, germination, and tube growth.probableQ05967
Exopolygalacturonase (Fragment) May function in depolymerizing pectin during pollen development, germination, and tube growth. Acts as an exo-polygalacturonase.probableQ6H9K0
Exopolygalacturonase (Fragment) May function in depolymerizing pectin during pollen development, germination, and tube growth. Acts as an exo-polygalacturonase.probableP24548

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.15Polygalacturonase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RMG, chain A
Confidence level:very confident
Coverage over the Query: 19-395
View the alignment between query and template
View the model in PyMOL
Template: 1DBG, chain A
Confidence level:confident
Coverage over the Query: 24-89,100-236
View the alignment between query and template
View the model in PyMOL