Citrus Sinensis ID: 015290


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MILNREEASASLEWKCSQAFGERNPDEELQDVDIVSAIEFDKTGDYLAVGDRGGRVILFETVGGKNTPNQHISRSELEKQMDFTSTSHPEYRYKTEFQSHEPEFDYLKSLEIEEKINRVRWCAAPNGSMFILSTNDKTIKLWKVRDQKVKKIKEMDHFPFVSSENTLLAEKNFMNEHNPPSFAHGYHLEWTENMATKIANVGNSVHARCQKVYPHAHDFNINSISNNSDCETFVSADDLRINLWNLEISDQCFNIVDMKPSNMDDLTEVITSAEFHPIYCNLLAYSSSRGFVRLVDMRQSALCDHSARILRDAAESHGSKSFFTEIIASISDIKFANDGQHLLSRDYMNLKLWDIRMDSTPVATFKIHEHLRPKLCDLYNNDSIFDKFECSVSGDGLHFATGSYRRDNG
cccccccccccccEEEEEECccccccccccccccEEEEEEcccccEEEECccccEEEEEEECcccccccccccccccEEECccccccccccEEEEEEECcccccEEEccEEEccEEEEEEEECcccccEEEEEccccEEEEEEEEccEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEEcccEEEECccEEcccccccEEEEEEcccccEEEECccccEEEEEcccccCEEEEEEccccccccccccEEEEEECcccccEEEEEccccEEEEEEccccccccccccEEEccccccccccccccccccEEEEEEcccccEEEEEcccEEEEEEcccccccEEEEEEccccccccccccccccccccEEEEEcccccEEEEECcccccc
**************KCSQAFGERNPDEELQDVDIVSAIEFDKTGDYLAVGDRGGRVILFETVGGKNTP*Q**************STSHPEYRYKTEFQSHEPEFDYLKSLEIEEKINRVRWCAAPNGSMFILSTNDKTIKLWKVRDQKVKKIKEMDHFPFVSSENTLLAEKNFMNEHNPPSFAHGYHLEWTENMATKIANVGNSVHARCQKVYPHAHDFNINSISNNSDCETFVSADDLRINLWNLEISDQCFNIVDMKPSNMDDLTEVITSAEFHPIYCNLLAYSSSRGFVRLVDMRQSALCDHSARILRDAAESHGSKSFFTEIIASISDIKFANDGQHLLSRDYMNLKLWDIRMDSTPVATFKIHEHLRPKLCDLYNNDSIFDKFECSVSGDGLHFATGSYRRD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILNREEASASLEWKCSQAFGERNPDEELQDVDIVSAIEFDKTGDYLAVGDRGGRVILFETVGGKNTPNQHISRSELEKQMDFTSTSHPEYRYKTEFQSHEPEFDYLKSLEIEEKINRVRWCAAPNGSMFILSTNDKTIKLWKVRDQKVKKIKEMDHFPFVSSENTLLAEKNFMNEHNPPSFAHGYHLEWTENMATKIANVGNSVHARCQKVYPHAHDFNINSISNNSDCETFVSADDLRINLWNLEISDQCFNIVDMKPSNMDDLTEVITSAEFHPIYCNLLAYSSSRGFVRLVDMRQSALCDHSARILRDAAESHGSKSFFTEIIASISDIKFANDGQHLLSRDYMNLKLWDIRMDSTPVATFKIHEHLRPKLCDLYNNDSIFDKFECSVSGDGLHFATGSYRRDNG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.probableQ0E2P1
Protein phosphatase PP2A regulatory subunit B Phosphatase 2A affects a variety of biological processes in the cell such as transcription, cell cycle progression and cellular morphogenesis, and provides an initial identification of critical substrates for this phosphatase. The regulatory subunit may direct the catalytic subunit to distinct, albeit overlapping, subsets of substrates.probableQ12702
Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform The B regulatory subunit may modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.probableQ39247

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DW8, chain B
Confidence level:very confident
Coverage over the Query: 10-63,85-158,176-408
View the alignment between query and template
View the model in PyMOL
Template: 4A11, chain B
Confidence level:confident
Coverage over the Query: 29-101,114-372,388-408
View the alignment between query and template
View the model in PyMOL