Citrus Sinensis ID: 015296

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41

MASMASIGSLKVPSSPSTATTSSNSNNHSRRSVVKRLAFSSSQLSGDKIFSKAVTGDRRSERRPIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYAKQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII

ccccccccccccccccccccccccccccccccEEEEEEEEEccccccEEEEEccccccccccccEEEcccEEEEcccccccccccccccEEEEEEccccccccccccHHHHHccccccccEEEEEEEccccccccccEEEEEEEcccccEEEcHHHcccccccccccccccccccccccccccccEEcEEEEEcHHHHHHHHHccccccccccccccccccccccEEEEEcccccccccccHHHHHHHccccccccccccccccccccccccccccccEEEEccEEEEEEEcccEEEEccEEEEEEEEcccEEccccEEEcEEEEcccccccHHHHHHHHHcccccEEEccccEEEcEEEccccEEccccEEEccccHHHHHcccccEEEEccEEEEccccEEcccccc

ccHHHHHHHcccccHHHHcccccccccHHHHHHHHHccccccccccccEEEEEEHcccccccccccEEEccccHHcHEEHHcccccccEEEEEEEcccccHHHccccccccHHHcEEcccEEEEEEcccHHHcccccEEEEEEEcccccHHHHHHccccccHccccccccEEcccHHHccccccEEEEEEEEEcHHHHHHHHHHHccccccccHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEEEccEEEEcEEEEEEEEEEEEEEcccEEEEcEEEEcccccccHHHHHHHHHcccccEEEccccEEEEEEEEcccEccccEEEEccccccccccccccEEEEccEEEEEcccEcccccEc

masmasigslkvpsspstattssnsnnhsRRSVVKRLAfsssqlsgdkifskavtgdrrserrpivvspqavsdsknsqtcldpeasrSVLGIIlgggagtrlypltkkrakpavplganyrlidipvsnclnsniSKIYVLTQFNSASLNRHLSRAYAKQLKAMKVdttilgldderakempyiASMGIYVISKDVMLNLlrdkfpgandfgsevipgatsiGMRVQAYLydgywediGTIEAFYNanlgitkkpipdfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLaakgsvpigigknshIKRAIIdknarigdnvkivnSDSVQEAARETDGYFIKSGIVTIIkdalipsgtii

masmasigslkvpsspstattssnsnnhsrrsVVKRLafsssqlsgdkifskavtgdrrserrpivvspqavsdsknsqtcldpeasrSVLGIILGGgagtrlypltkkrakpavplGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYAKQLKAMKvdttilgldderakempyIASMGIYVISKDVMLNLLRDKFPGANDFgsevipgatsiGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAkgsvpigigknshikraiidknarigdnvkivnsdsvqeaARETdgyfiksgivtiikdalipsgtii

MASMASIGSLkvpsspstattssnsnnhsrrsvvkrLAFSSSQLSGDKIFSKAVTGDRRSERRPIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYAKQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII

****************************************************************************************SVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYAKQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIP*****

**************************************FSSSQLSGDKIFSKAVTGDRRSERRPIVVSPQAVSDSKNS***LDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYAKQLKAMKVDTTI*******AKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII

********************************VVKRLAFSSSQLSGDKIFSKA*****************************DPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYAKQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII

************************SNNHSRRSVVKRLAFSSSQLSGDKIFSKAVTGDRRSERRPIVVSPQAVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYAKQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPS*TII

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		409	2.2.26 [Sep-21-2011]
P23509		521	Glucose-1-phosphate adeny	N/A	no	0.594	0.466	0.94	1e-140
P52416		508	Glucose-1-phosphate adeny	N/A	no	0.608	0.490	0.928	1e-139
P52417		512	Glucose-1-phosphate adeny	N/A	no	0.601	0.480	0.924	1e-139
Q9M462		520	Glucose-1-phosphate adeny	N/A	no	0.557	0.438	0.916	1e-139
Q42882		521	Glucose-1-phosphate adeny	N/A	no	0.594	0.466	0.924	1e-137
P55228		520	Glucose-1-phosphate adeny	yes	no	0.586	0.461	0.9	1e-136
P30523		473	Glucose-1-phosphate adeny	N/A	no	0.613	0.530	0.900	1e-134
P55238		513	Glucose-1-phosphate adeny	N/A	no	0.613	0.489	0.896	1e-133
P15280		514	Glucose-1-phosphate adeny	no	no	0.613	0.488	0.884	1e-133
P55232		489	Glucose-1-phosphate adeny	N/A	no	0.581	0.486	0.892	1e-131

>sp\|P23509\|GLGS_SOLTU Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic OS=Solanum tuberosum PE=1 SV=2	Back alignment and function desciption

 Score =  498 bits (1282), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 235/250 (94%), Positives = 246/250 (98%)

Query: 160 KQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG 219
           +QL+AMKVDTTILGLDD+RAKEMP+IASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG
Sbjct: 272 EQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG 331

Query: 220 ATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPS 279
           ATS+GMRVQAYLYDGYWEDIGTIEAFYNANLGITKKP+PDFSFYDRSAPIYTQPRYLPPS
Sbjct: 332 ATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPS 391

Query: 280 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFL 339
           KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIED+LLMGADYYETDADR+ L
Sbjct: 392 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLL 451

Query: 340 AAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIK 399
           AAKGSVPIGIGKN HIKRAIIDKNARIGDNVKI+N D+VQEAARETDGYFIKSGIVT+IK
Sbjct: 452 AAKGSVPIGIGKNCHIKRAIIDKNARIGDNVKIINKDNVQEAARETDGYFIKSGIVTVIK 511

Query: 400 DALIPSGTII 409
           DALIPSG II
Sbjct: 512 DALIPSGIII 521

This protein plays a role in synthesis of starch. It catalyzes the synthesis of the activated glycosyl donor, ADP-glucose from Glc-1-P and ATP.
Solanum tuberosum (taxid: 4113)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 2EC: 7

>sp\|P52416\|GLGS1_VICFA Glucose-1-phosphate adenylyltransferase small subunit 1, chloroplastic OS=Vicia faba GN=AGPC PE=2 SV=1	Back alignment and function description

>sp\|P52417\|GLGS2_VICFA Glucose-1-phosphate adenylyltransferase small subunit 2, chloroplastic OS=Vicia faba GN=AGPP PE=2 SV=1	Back alignment and function description

>sp\|Q9M462\|GLGS_BRANA Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic OS=Brassica napus GN=AGPS1 PE=2 SV=1	Back alignment and function description

>sp\|Q42882\|GLGS_SOLLC Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic OS=Solanum lycopersicum PE=2 SV=1	Back alignment and function description

>sp\|P55228\|GLGS_ARATH Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic OS=Arabidopsis thaliana GN=APS1 PE=2 SV=2	Back alignment and function description

>sp\|P30523\|GLGS_WHEAT Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic OS=Triticum aestivum GN=AGP-S PE=2 SV=1	Back alignment and function description

>sp\|P55238\|GLGS_HORVU Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic OS=Hordeum vulgare PE=2 SV=1	Back alignment and function description

>sp\|P15280\|GLGS_ORYSJ Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic OS=Oryza sativa subsp. japonica GN=AGPS PE=2 SV=4	Back alignment and function description

>sp\|P55232\|GLGS_BETVU Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic (Fragment) OS=Beta vulgaris GN=AGPB1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		409
111660950		520	ADP-glucose pyrophosphorylase small subu	0.611	0.480	0.992	1e-144
89089752		520	ADP-glucose pyrophosphorylase small subu	0.599	0.471	0.964	1e-142
255567204		521	glucose-1-phosphate adenylyltransferase,	0.591	0.464	0.952	1e-140
225447450		509	PREDICTED: glucose-1-phosphate adenylylt	0.591	0.475	0.948	1e-140
224131934		522	predicted protein [Populus trichocarpa]	0.596	0.467	0.948	1e-140
2625084		525	ADP-glucose pyrophosphorylase small subu	0.601	0.468	0.944	1e-140
449453628		521	PREDICTED: glucose-1-phosphate adenylylt	0.579	0.454	0.944	1e-139
157042757		520	ADP-glucose pyrophosphorylase small subu	0.599	0.471	0.956	1e-139
357462397		514	Glucose-1-phosphate adenylyltransferase	0.586	0.466	0.94	1e-139
295684201		516	ADP glucose pyrophosphorylase small subu	0.606	0.480	0.936	1e-139

>gi\|111660950\|gb\|ABH12112.1\| ADP-glucose pyrophosphorylase small subunit [Citrus sinensis]	Back alignment and taxonomy information

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 248/250 (99%), Positives = 250/250 (100%)

Query: 160 KQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG 219
           +QLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG
Sbjct: 271 EQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG 330

Query: 220 ATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPS 279
           ATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPS
Sbjct: 331 ATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPS 390

Query: 280 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFL 339
           KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFL
Sbjct: 391 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFL 450

Query: 340 AAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIK 399
           AAKGSVPIGIGKNSHIKRAIIDK+ARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIK
Sbjct: 451 AAKGSVPIGIGKNSHIKRAIIDKDARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIK 510

Query: 400 DALIPSGTII 409
           DALIPSGTII
Sbjct: 511 DALIPSGTII 520

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|89089752\|gb\|ABD60582.1\| ADP-glucose pyrophosphorylase small subunit [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|255567204\|ref\|XP_002524583.1\| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis] gi\|223536136\|gb\|EEF37791.1\| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225447450\|ref\|XP_002263255.1\| PREDICTED: glucose-1-phosphate adenylyltransferase small subunit, chloroplastic [Vitis vinifera] gi\|296085074\|emb\|CBI28489.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224131934\|ref\|XP_002321214.1\| predicted protein [Populus trichocarpa] gi\|118486311\|gb\|ABK94997.1\| unknown [Populus trichocarpa] gi\|222861987\|gb\|EEE99529.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|2625084\|gb\|AAB91462.1\| ADP-glucose pyrophosphorylase small subunit [Cucumis melo]	Back alignment and taxonomy information

>gi\|449453628\|ref\|XP_004144558.1\| PREDICTED: glucose-1-phosphate adenylyltransferase small subunit, chloroplastic-like [Cucumis sativus] gi\|449520066\|ref\|XP_004167055.1\| PREDICTED: glucose-1-phosphate adenylyltransferase small subunit, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|157042757\|gb\|ABV02030.1\| ADP-glucose pyrophosphorylase small subunit [Nicotiana langsdorffii x Nicotiana sanderae]	Back alignment and taxonomy information

>gi\|357462397\|ref\|XP_003601480.1\| Glucose-1-phosphate adenylyltransferase [Medicago truncatula] gi\|355490528\|gb\|AES71731.1\| Glucose-1-phosphate adenylyltransferase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|295684201\|gb\|ADG27450.1\| ADP glucose pyrophosphorylase small subunit 1-like protein [Malus x domestica]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		409
TAIR\|locus:2156263		520	ADG1 "ADP glucose pyrophosphor	0.611	0.480	0.9	6e-172
UNIPROTKB\|P15280		514	AGPS "Glucose-1-phosphate aden	0.611	0.486	0.888	1.3e-167
TAIR\|locus:2182132		522	APL1 "ADP glucose pyrophosphor	0.601	0.471	0.544	2.2e-101
TAIR\|locus:2199241		518	APL2 "ADPGLC-PPase large subun	0.682	0.538	0.473	8.7e-98
TAIR\|locus:2136358		521	APL3 [Arabidopsis thaliana (ta	0.689	0.541	0.437	1.2e-89
TAIR\|locus:2032003		476	APS2 "AT1G05610" [Arabidopsis	0.540	0.464	0.475	4.6e-80
TAIR\|locus:2049364		523	APL4 [Arabidopsis thaliana (ta	0.745	0.583	0.434	2.5e-65
UNIPROTKB\|Q9KRB5		405	glgC1 "Glucose-1-phosphate ade	0.337	0.340	0.327	6.3e-32
TIGR_CMR\|VC_1727		405	VC_1727 "glucose-1-phosphate a	0.337	0.340	0.327	6.3e-32
UNIPROTKB\|Q9KLP4		407	glgC2 "Glucose-1-phosphate ade	0.176	0.176	0.513	1.1e-29

TAIR\|locus:2156263 ADG1 "ADP glucose pyrophosphorylase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1197 (426.4 bits), Expect = 6.0e-172, Sum P(2) = 6.0e-172
 Identities = 225/250 (90%), Positives = 245/250 (98%)

Query:   160 KQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG 219
             + LKAMKVDTTILGLDD+RAKEMP+IASMGIYV+S+DVML+LLR++FPGANDFGSEVIPG
Sbjct:   271 EHLKAMKVDTTILGLDDQRAKEMPFIASMGIYVVSRDVMLDLLRNQFPGANDFGSEVIPG 330

Query:   220 ATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPS 279
             ATS+G+RVQAYLYDGYWEDIGTIEAFYNANLGITKKP+PDFSFYDRSAPIYTQPRYLPPS
Sbjct:   331 ATSLGLRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPS 390

Query:   280 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFL 339
             KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIED+LLMGADYYET  ++  L
Sbjct:   391 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDSLLMGADYYETATEKSLL 450

Query:   340 AAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIK 399
             +AKGSVPIGIGKNSHIKRAIIDKNARIGDNVKI+NSD+VQEAARETDGYFIKSGIVT+IK
Sbjct:   451 SAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIINSDNVQEAARETDGYFIKSGIVTVIK 510

Query:   400 DALIPSGTII 409
             DALIP+GT+I
Sbjct:   511 DALIPTGTVI 520

GO:0008878 "glucose-1-phosphate adenylyltransferase activity" evidence=IEA;ISS;IMP;IDA

GO:0009058 "biosynthetic process" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0016779 "nucleotidyltransferase activity" evidence=IEA

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0048046 "apoplast" evidence=IDA

GO:0019252 "starch biosynthetic process" evidence=RCA;IMP;TAS

GO:0048573 "photoperiodism, flowering" evidence=IMP

GO:0000023 "maltose metabolic process" evidence=RCA

GO:0006098 "pentose-phosphate shunt" evidence=RCA

GO:0009637 "response to blue light" evidence=RCA

GO:0009644 "response to high light intensity" evidence=RCA

GO:0009744 "response to sucrose stimulus" evidence=RCA

GO:0009793 "embryo development ending in seed dormancy" evidence=RCA

GO:0009853 "photorespiration" evidence=RCA

GO:0010027 "thylakoid membrane organization" evidence=RCA

GO:0010114 "response to red light" evidence=RCA

GO:0010155 "regulation of proton transport" evidence=RCA

GO:0010218 "response to far red light" evidence=RCA

GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA

GO:0016226 "iron-sulfur cluster assembly" evidence=RCA

GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA

GO:0019760 "glucosinolate metabolic process" evidence=RCA

GO:0019761 "glucosinolate biosynthetic process" evidence=RCA

GO:0043085 "positive regulation of catalytic activity" evidence=RCA

GO:0048481 "ovule development" evidence=RCA

GO:0030931 "heterotetrameric ADPG pyrophosphorylase complex" evidence=IMP

UNIPROTKB\|P15280 AGPS "Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2182132 APL1 "ADP glucose pyrophosphorylase large subunit 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2199241 APL2 "ADPGLC-PPase large subunit" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2136358 APL3 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2032003 APS2 "AT1G05610" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2049364 APL4 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KRB5 glgC1 "Glucose-1-phosphate adenylyltransferase 1" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_1727 VC_1727 "glucose-1-phosphate adenylyltransferase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KLP4 glgC2 "Glucose-1-phosphate adenylyltransferase 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P55228	GLGS_ARATH	2, ., 7, ., 7, ., 2, 7	0.9	0.5867	0.4615	yes	no
P52416	GLGS1_VICFA	2, ., 7, ., 7, ., 2, 7	0.9282	0.6088	0.4901	N/A	no
P52417	GLGS2_VICFA	2, ., 7, ., 7, ., 2, 7	0.9243	0.6014	0.4804	N/A	no
Q42882	GLGS_SOLLC	2, ., 7, ., 7, ., 2, 7	0.924	0.5941	0.4664	N/A	no
Q9M462	GLGS_BRANA	2, ., 7, ., 7, ., 2, 7	0.916	0.5574	0.4384	N/A	no
P30523	GLGS_WHEAT	2, ., 7, ., 7, ., 2, 7	0.9003	0.6136	0.5306	N/A	no
P23509	GLGS_SOLTU	2, ., 7, ., 7, ., 2, 7	0.94	0.5941	0.4664	N/A	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.7.7	0.976
4th Layer	2.7.7.27	0.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		409
PLN02241		436	PLN02241, PLN02241, glucose-1-phosphate adenylyltr	1e-162
PRK02862		429	PRK02862, glgC, glucose-1-phosphate adenylyltransf	1e-140
TIGR02091		361	TIGR02091, glgC, glucose-1-phosphate adenylyltrans	3e-66
COG0448		393	COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb	7e-60
PLN02241		436	PLN02241, PLN02241, glucose-1-phosphate adenylyltr	2e-48
PRK02862		429	PRK02862, glgC, glucose-1-phosphate adenylyltransf	3e-46
PRK00844		407	PRK00844, glgC, glucose-1-phosphate adenylyltransf	2e-38
PRK05293		380	PRK05293, glgC, glucose-1-phosphate adenylyltransf	4e-35
TIGR02091		361	TIGR02091, glgC, glucose-1-phosphate adenylyltrans	2e-34
cd02508		200	cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory	1e-32
COG0448		393	COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb	1e-31
cd04651		104	cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly	2e-31
PRK00725		425	PRK00725, glgC, glucose-1-phosphate adenylyltransf	7e-31
PRK00844		407	PRK00844, glgC, glucose-1-phosphate adenylyltransf	3e-30
PRK00725		425	PRK00725, glgC, glucose-1-phosphate adenylyltransf	4e-28
pfam00483		247	pfam00483, NTP_transferase, Nucleotidyl transferas	2e-24
PRK05293		380	PRK05293, glgC, glucose-1-phosphate adenylyltransf	9e-21
TIGR02092		369	TIGR02092, glgD, glucose-1-phosphate adenylyltrans	2e-20
COG1208		358	COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph	2e-17
cd03356		79	cd03356, LbH_G1P_AT_C_like, Left-handed parallel b	1e-14
cd02508		200	cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory	2e-14
pfam00483		247	pfam00483, NTP_transferase, Nucleotidyl transferas	2e-13
cd00208		78	cd00208, LbetaH, Left-handed parallel beta-Helix (	3e-08
COG1208		358	COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph	4e-08
cd04181		217	cd04181, NTP_transferase, NTP_transferases catalyz	5e-08
cd02507		216	cd02507, eIF-2B_gamma_N_like, The N-terminal of eI	2e-07
cd04181		217	cd04181, NTP_transferase, NTP_transferases catalyz	3e-07
COG1209		286	COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel	1e-06
TIGR02092		369	TIGR02092, glgD, glucose-1-phosphate adenylyltrans	4e-06
COG1044		338	COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	4e-06
cd03352		205	cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl	6e-06
cd02538		240	cd02538, G1P_TT_short, G1P_TT_short is the short f	2e-05
cd04189		236	cd04189, G1P_TT_long, G1P_TT_long represents the l	2e-05
cd04198		214	cd04198, eIF-2B_gamma_N, The N-terminal domain of	3e-05
cd03353		193	cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph	1e-04
cd06426		220	cd06426, NTP_transferase_like_2, NTP_trnasferase_l	1e-04
cd06426		220	cd06426, NTP_transferase_like_2, NTP_trnasferase_l	1e-04
cd06422		221	cd06422, NTP_transferase_like_1, NTP_transferase_l	2e-04
TIGR01173		451	TIGR01173, glmU, UDP-N-acetylglucosamine diphospho	3e-04
TIGR03992		393	TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph	7e-04
TIGR01208		353	TIGR01208, rmlA_long, glucose-1-phosphate thymidyl	7e-04
cd05787		79	cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit	9e-04
cd02523		229	cd02523, PC_cytidylyltransferase, Phosphocholine c	0.001
COG1207		460	COG1207, GlmU, N-acetylglucosamine-1-phosphate uri	0.001
TIGR01207		286	TIGR01207, rmlA, glucose-1-phosphate thymidylyltra	0.002
TIGR01208		353	TIGR01208, rmlA_long, glucose-1-phosphate thymidyl	0.003
PRK15480		292	PRK15480, PRK15480, glucose-1-phosphate thymidylyl	0.003

>gnl\|CDD\|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase	Back alignment and domain information

 Score =  462 bits (1192), Expect = e-162
 Identities = 167/251 (66%), Positives = 200/251 (79%), Gaps = 1/251 (0%)

Query: 159 AKQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIP 218
             +LKAM+VDTT+LGL  E AKE PYIASMGIYV  KDV+L LLR +FP ANDFGSE+IP
Sbjct: 187 GDELKAMQVDTTVLGLSPEEAKEKPYIASMGIYVFKKDVLLKLLRWRFPTANDFGSEIIP 246

Query: 219 GATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPP 278
           GA   G  VQAYL+DGYWEDIGTI++FY ANL +TK+P P FSFYD  APIYT PR+LPP
Sbjct: 247 GAIKEGYNVQAYLFDGYWEDIGTIKSFYEANLALTKQP-PKFSFYDPDAPIYTSPRFLPP 305

Query: 279 SKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRF 338
           SK+ D  +TDS+I  GC ++ CKI HSVVGLRS I EG  IEDT++MGADYYET+ +   
Sbjct: 306 SKIEDCRITDSIISHGCFLRECKIEHSVVGLRSRIGEGVEIEDTVMMGADYYETEEEIAS 365

Query: 339 LAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTII 398
           L A+G VPIGIG+N+ I+ AIIDKNARIG NV I+N D VQEA RE +GY+I+SGIV I+
Sbjct: 366 LLAEGKVPIGIGENTKIRNAIIDKNARIGKNVVIINKDGVQEADREEEGYYIRSGIVVIL 425

Query: 399 KDALIPSGTII 409
           K+A+IP GT+I
Sbjct: 426 KNAVIPDGTVI 436

Length = 436

>gnl\|CDD\|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>gnl\|CDD\|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>gnl\|CDD\|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>gnl\|CDD\|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch	Back alignment and domain information

>gnl\|CDD\|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>gnl\|CDD\|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|215940 pfam00483, NTP_transferase, Nucleotidyl transferase	Back alignment and domain information

>gnl\|CDD\|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233721 TIGR02092, glgD, glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>gnl\|CDD\|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>gnl\|CDD\|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch	Back alignment and domain information

>gnl\|CDD\|215940 pfam00483, NTP_transferase, Nucleotidyl transferase	Back alignment and domain information

>gnl\|CDD\|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>gnl\|CDD\|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars	Back alignment and domain information

>gnl\|CDD\|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity	Back alignment and domain information

>gnl\|CDD\|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars	Back alignment and domain information

>gnl\|CDD\|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|233721 TIGR02092, glgD, glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>gnl\|CDD\|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>gnl\|CDD\|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>gnl\|CDD\|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>gnl\|CDD\|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>gnl\|CDD\|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>gnl\|CDD\|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>gnl\|CDD\|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family	Back alignment and domain information

>gnl\|CDD\|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family	Back alignment and domain information

>gnl\|CDD\|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family	Back alignment and domain information

>gnl\|CDD\|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>gnl\|CDD\|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>gnl\|CDD\|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline	Back alignment and domain information

>gnl\|CDD\|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form	Back alignment and domain information

>gnl\|CDD\|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>gnl\|CDD\|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		409
COG0448		393	GlgC ADP-glucose pyrophosphorylase [Carbohydrate t	100.0
KOG1322		371	consensus GDP-mannose pyrophosphorylase/mannose-1-	100.0
PLN02241		436	glucose-1-phosphate adenylyltransferase	100.0
PRK02862		429	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
PRK00844		407	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
PRK05293		380	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
PRK00725		425	glgC glucose-1-phosphate adenylyltransferase; Prov	100.0
COG1208		358	GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas	100.0
TIGR02092		369	glgD glucose-1-phosphate adenylyltransferase, GlgD	100.0
TIGR02091		361	glgC glucose-1-phosphate adenylyltransferase. This	100.0
PRK14359		430	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
TIGR01208		353	rmlA_long glucose-1-phosphate thymidylylransferase	100.0
PRK14355		459	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14352		482	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14353		446	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
TIGR01173		451	glmU UDP-N-acetylglucosamine diphosphorylase/gluco	100.0
PRK09451		456	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
COG1207		460	GlmU N-acetylglucosamine-1-phosphate uridyltransfe	100.0
PRK14356		456	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14358		481	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14354		458	glmU bifunctional N-acetylglucosamine-1-phosphate	100.0
PRK14357		448	glmU bifunctional N-acetylglucosamine-1-phosphate	99.98
KOG1461		673	consensus Translation initiation factor 2B, epsilo	99.97
PRK14360		450	glmU bifunctional N-acetylglucosamine-1-phosphate	99.97
KOG1460		407	consensus GDP-mannose pyrophosphorylase [Carbohydr	99.97
KOG1462		433	consensus Translation initiation factor 2B, gamma	99.95
COG1209		286	RfbA dTDP-glucose pyrophosphorylase [Cell envelope	99.95
PF00483		248	NTP_transferase: Nucleotidyl transferase This Pros	99.94
TIGR01105		297	galF UTP-glucose-1-phosphate uridylyltransferase,	99.94
PRK10122		297	GalU regulator GalF; Provisional	99.93
cd06425		233	M1P_guanylylT_B_like_N N-terminal domain of the M1	99.92
cd02541		267	UGPase_prokaryotic Prokaryotic UGPase catalyses th	99.92
PRK15480		292	glucose-1-phosphate thymidylyltransferase RfbA; Pr	99.92
cd06428		257	M1P_guanylylT_A_like_N N-terminal domain of M1P_gu	99.91
TIGR02623		254	G1P_cyt_trans glucose-1-phosphate cytidylyltransfe	99.91
cd02538		240	G1P_TT_short G1P_TT_short is the short form of glu	99.91
cd04189		236	G1P_TT_long G1P_TT_long represents the long form o	99.91
TIGR01099		260	galU UTP-glucose-1-phosphate uridylyltransferase.	99.9
cd06422		221	NTP_transferase_like_1 NTP_transferase_like_1 is a	99.89
TIGR01207		286	rmlA glucose-1-phosphate thymidylyltransferase, sh	99.89
PRK13389		302	UTP--glucose-1-phosphate uridylyltransferase subun	99.89
cd02524		253	G1P_cytidylyltransferase G1P_cytidylyltransferase	99.89
cd06426		220	NTP_transferase_like_2 NTP_trnasferase_like_2 is a	99.88
cd06915		223	NTP_transferase_WcbM_like WcbM_like is a subfamily	99.87
cd02508		200	ADP_Glucose_PP ADP-glucose pyrophosphorylase is in	99.86
cd02523		229	PC_cytidylyltransferase Phosphocholine cytidylyltr	99.85
cd04181		217	NTP_transferase NTP_transferases catalyze the tran	99.85
COG1210		291	GalU UDP-glucose pyrophosphorylase [Cell envelope	99.85
cd04183		231	GT2_BcE_like GT2_BcbE_like is likely involved in t	99.81
COG1213		239	Predicted sugar nucleotidyltransferases [Cell enve	99.71
cd02509		274	GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf	99.71
cd02540		229	GT2_GlmU_N_bac N-terminal domain of bacterial GlmU	99.71
PRK05450		245	3-deoxy-manno-octulosonate cytidylyltransferase; P	99.65
TIGR01479		468	GMP_PMI mannose-1-phosphate guanylyltransferase/ma	99.64
cd02517		239	CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th	99.62
PRK13368		238	3-deoxy-manno-octulosonate cytidylyltransferase; P	99.58
cd04197		217	eIF-2B_epsilon_N The N-terminal domain of epsilon	99.57
TIGR03532		231	DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla	99.57
cd05636		163	LbH_G1P_TT_C_like Putative glucose-1-phosphate thy	99.56
PRK15460		478	cpsB mannose-1-phosphate guanyltransferase; Provis	99.54
COG4750		231	LicC CTP:phosphocholine cytidylyltransferase invol	99.53
cd04651		104	LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera	99.52
COG1044		338	LpxD UDP-3-O-[3-hydroxymyristoyl]	99.5
cd03351		254	LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr	99.5
COG0836		333	{ManC} Mannose-1-phosphate guanylyltransferase [Ce	99.49
TIGR01853		324	lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam	99.48
TIGR01852		254	lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac	99.47
cd03353		193	LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl	99.47
PRK05289		262	UDP-N-acetylglucosamine acyltransferase; Provision	99.46
PRK12461		255	UDP-N-acetylglucosamine acyltransferase; Provision	99.43
PRK00892		343	lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac	99.42
cd02507		216	eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma	99.39
cd04198		214	eIF-2B_gamma_N The N-terminal domain of gamma subu	99.37
cd03351		254	LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr	99.36
PLN02296		269	carbonate dehydratase	99.34
TIGR02287		192	PaaY phenylacetic acid degradation protein PaaY. M	99.33
TIGR01852		254	lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac	99.32
cd04745		155	LbH_paaY_like paaY-like: This group is composed by	99.32
cd04646		164	LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact	99.31
cd03353		193	LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl	99.31
cd03352		205	LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas	99.28
PRK05289		262	UDP-N-acetylglucosamine acyltransferase; Provision	99.27
TIGR01173		451	glmU UDP-N-acetylglucosamine diphosphorylase/gluco	99.26
TIGR03308		204	phn_thr-fam phosphonate metabolim protein, transfe	99.25
COG1044		338	LpxD UDP-3-O-[3-hydroxymyristoyl]	99.25
PLN02472		246	uncharacterized protein	99.23
cd05636		163	LbH_G1P_TT_C_like Putative glucose-1-phosphate thy	99.22
PRK11830		272	dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-	99.21
PRK13627		196	carnitine operon protein CaiE; Provisional	99.2
PRK00155		227	ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl	99.2
TIGR01853		324	lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam	99.2
PRK00892		343	lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac	99.2
cd03352		205	LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas	99.19
cd04652		81	LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal	99.19
cd03356		79	LbH_G1P_AT_C_like Left-handed parallel beta-Helix	99.19
COG1043		260	LpxA Acyl-[acyl carrier protein]	99.18
cd05787		79	LbH_eIF2B_epsilon eIF-2B epsilon subunit, central	99.18
cd04650		154	LbH_FBP Ferripyochelin Binding Protein (FBP): FBP	99.18
PRK12461		255	UDP-N-acetylglucosamine acyltransferase; Provision	99.18
cd00710		167	LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo	99.17
PRK09382		378	ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp	99.17
COG1043		260	LpxA Acyl-[acyl carrier protein]	99.16
PRK14356		456	glmU bifunctional N-acetylglucosamine-1-phosphate	99.16
cd04645		153	LbH_gamma_CA_like Gamma carbonic anhydrase-like: T	99.16
PLN02917		293	CMP-KDO synthetase	99.15
COG2266		177	GTP:adenosylcobinamide-phosphate guanylyltransfera	99.14
cd04652		81	LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal	99.14
TIGR03308		204	phn_thr-fam phosphonate metabolim protein, transfe	99.13
TIGR00965		269	dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate	99.12
cd04745		155	LbH_paaY_like paaY-like: This group is composed by	99.12
TIGR00453		217	ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl	99.12
cd03360		197	LbH_AT_putative Putative Acyltransferase (AT), Lef	99.12
COG0663		176	PaaY Carbonic anhydrases/acetyltransferases, isole	99.11
cd05824		80	LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr	99.11
PRK14357		448	glmU bifunctional N-acetylglucosamine-1-phosphate	99.1
TIGR00454		183	conserved hypothetical protein TIGR00454. At this	99.1
PRK14358		481	glmU bifunctional N-acetylglucosamine-1-phosphate	99.1
TIGR00965		269	dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate	99.09
KOG1461		673	consensus Translation initiation factor 2B, epsilo	99.09
cd02516		218	CDP-ME_synthetase CDP-ME synthetase is involved in	99.09
PRK14353		446	glmU bifunctional N-acetylglucosamine-1-phosphate	99.08
PRK14355		459	glmU bifunctional N-acetylglucosamine-1-phosphate	99.07
PRK14352		482	glmU bifunctional N-acetylglucosamine-1-phosphate	99.07
PLN02296		269	carbonate dehydratase	99.06
PRK09451		456	glmU bifunctional N-acetylglucosamine-1-phosphate	99.06
cd03350		139	LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d	99.06
PRK13627		196	carnitine operon protein CaiE; Provisional	99.06
PLN02728		252	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	99.05
TIGR03310		188	matur_ygfJ molybdenum hydroxylase accessory protei	99.05
TIGR02287		192	PaaY phenylacetic acid degradation protein PaaY. M	99.04
TIGR03570		201	NeuD_NnaD sugar O-acyltransferase, sialic acid O-a	99.04
cd04646		164	LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact	99.03
cd04645		153	LbH_gamma_CA_like Gamma carbonic anhydrase-like: T	99.03
cd03359		161	LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact	99.03
cd03358		119	LbH_WxcM_N_like WcxM-like, Left-handed parallel be	99.02
PRK00317		193	mobA molybdopterin-guanine dinucleotide biosynthes	99.01
PRK14354		458	glmU bifunctional N-acetylglucosamine-1-phosphate	99.01
PRK11830		272	dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-	98.99
PRK13385		230	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	98.99
cd03356		79	LbH_G1P_AT_C_like Left-handed parallel beta-Helix	98.99
cd04651		104	LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera	98.99
PRK14360		450	glmU bifunctional N-acetylglucosamine-1-phosphate	98.98
PRK00560		196	molybdopterin-guanine dinucleotide biosynthesis pr	98.97
COG2068		199	Uncharacterized MobA-related protein [General func	98.97
TIGR03532		231	DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla	98.97
cd04650		154	LbH_FBP Ferripyochelin Binding Protein (FBP): FBP	98.96
COG1207		460	GlmU N-acetylglucosamine-1-phosphate uridyltransfe	98.96
PRK14359		430	glmU bifunctional N-acetylglucosamine-1-phosphate	98.95
cd03350		139	LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d	98.92
TIGR00466		238	kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe	98.92
PLN02472		246	uncharacterized protein	98.92
cd05787		79	LbH_eIF2B_epsilon eIF-2B epsilon subunit, central	98.92
cd00710		167	LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo	98.92
cd03360		197	LbH_AT_putative Putative Acyltransferase (AT), Lef	98.91
KOG1462		433	consensus Translation initiation factor 2B, gamma	98.91
cd03358		119	LbH_WxcM_N_like WcxM-like, Left-handed parallel be	98.9
cd05824		80	LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr	98.86
TIGR03570		201	NeuD_NnaD sugar O-acyltransferase, sialic acid O-a	98.85
cd02503		181	MobA MobA catalyzes the formation of molybdopterin	98.84
COG0663		176	PaaY Carbonic anhydrases/acetyltransferases, isole	98.79
cd04182		186	GT_2_like_f GT_2_like_f is a subfamily of the glyc	98.76
PF12804		160	NTP_transf_3: MobA-like NTP transferase domain; PD	98.76
cd05635		101	LbH_unknown Uncharacterized proteins, Left-handed	98.73
PLN02694		294	serine O-acetyltransferase	98.7
cd04649		147	LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah	98.7
PRK02726		200	molybdopterin-guanine dinucleotide biosynthesis pr	98.68
cd02518		233	GT2_SpsF SpsF is a glycosyltrnasferase implicated	98.66
cd04649		147	LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah	98.66
cd04647		109	LbH_MAT_like Maltose O-acyltransferase (MAT)-like:	98.66
cd02513		223	CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-	98.66
PRK14489		366	putative bifunctional molybdopterin-guanine dinucl	98.64
COG2171		271	DapD Tetrahydrodipicolinate N-succinyltransferase	98.63
PRK05293		380	glgC glucose-1-phosphate adenylyltransferase; Prov	98.62
COG1211		230	IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt	98.6
cd05635		101	LbH_unknown Uncharacterized proteins, Left-handed	98.6
cd03359		161	LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact	98.58
PRK02862		429	glgC glucose-1-phosphate adenylyltransferase; Prov	98.57
TIGR01172		162	cysE serine O-acetyltransferase. Cysteine biosynth	98.57
cd00208		78	LbetaH Left-handed parallel beta-Helix (LbetaH or	98.56
TIGR01208		353	rmlA_long glucose-1-phosphate thymidylylransferase	98.53
TIGR02092		369	glgD glucose-1-phosphate adenylyltransferase, GlgD	98.51
TIGR03536		341	DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl	98.5
KOG3121		184	consensus Dynactin, subunit p25 [Cytoskeleton]	98.5
TIGR03536		341	DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl	98.5
PRK10502		182	putative acyl transferase; Provisional	98.48
PRK11132		273	cysE serine acetyltransferase; Provisional	98.48
PRK10502		182	putative acyl transferase; Provisional	98.47
PRK10092		183	maltose O-acetyltransferase; Provisional	98.47
cd03357		169	LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and	98.47
PLN02357		360	serine acetyltransferase	98.47
PRK09527		203	lacA galactoside O-acetyltransferase; Reviewed	98.46
PLN02241		436	glucose-1-phosphate adenylyltransferase	98.46
COG1208		358	GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas	98.45
TIGR03535		319	DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo	98.45
TIGR03202		190	pucB xanthine dehydrogenase accessory protein pucB	98.44
PRK09677		192	putative lipopolysaccharide biosynthesis O-acetyl	98.42
cd03354		101	LbH_SAT Serine acetyltransferase (SAT): SAT cataly	98.42
TIGR02091		361	glgC glucose-1-phosphate adenylyltransferase. This	98.41
PF01128		221	IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly	98.41
PRK14490		369	putative bifunctional molybdopterin-guanine dinucl	98.4
cd03357		169	LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and	98.39
TIGR02665		186	molyb_mobA molybdopterin-guanine dinucleotide bios	98.38
COG0448		393	GlgC ADP-glucose pyrophosphorylase [Carbohydrate t	98.38
PRK00844		407	glgC glucose-1-phosphate adenylyltransferase; Prov	98.33
PRK00725		425	glgC glucose-1-phosphate adenylyltransferase; Prov	98.32
cd04180		266	UGPase_euk_like Eukaryotic UGPase-like includes UD	98.31
PRK09677		192	putative lipopolysaccharide biosynthesis O-acetyl	98.3
COG2171		271	DapD Tetrahydrodipicolinate N-succinyltransferase	98.3
TIGR01172		162	cysE serine O-acetyltransferase. Cysteine biosynth	98.29
cd05825		107	LbH_wcaF_like wcaF-like: This group is composed of	98.27
KOG4042		190	consensus Dynactin subunit p27/WS-3, involved in t	98.25
PRK11132		273	cysE serine acetyltransferase; Provisional	98.25
cd03354		101	LbH_SAT Serine acetyltransferase (SAT): SAT cataly	98.22
cd00208		78	LbetaH Left-handed parallel beta-Helix (LbetaH or	98.21
TIGR03535		319	DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo	98.21
PRK09527		203	lacA galactoside O-acetyltransferase; Reviewed	98.21
PLN02694		294	serine O-acetyltransferase	98.2
PRK10092		183	maltose O-acetyltransferase; Provisional	98.2
PRK10191		146	putative acyl transferase; Provisional	98.17
PLN02739		355	serine acetyltransferase	98.17
cd04193		323	UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala	98.15
PRK10191		146	putative acyl transferase; Provisional	98.14
cd05825		107	LbH_wcaF_like wcaF-like: This group is composed of	98.13
COG1212		247	KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase	98.1
COG1045		194	CysE Serine acetyltransferase [Amino acid transpor	98.08
PLN02357		360	serine acetyltransferase	98.07
cd03349		145	LbH_XAT Xenobiotic acyltransferase (XAT): The XAT	98.06
PTZ00339		482	UDP-N-acetylglucosamine pyrophosphorylase; Provisi	98.05
PLN02739		355	serine acetyltransferase	98.05
COG0746		192	MobA Molybdopterin-guanine dinucleotide biosynthes	98.02
cd04647		109	LbH_MAT_like Maltose O-acyltransferase (MAT)-like:	97.93
KOG1322		371	consensus GDP-mannose pyrophosphorylase/mannose-1-	97.83
TIGR02353		695	NRPS_term_dom non-ribosomal peptide synthetase ter	97.74
COG1045		194	CysE Serine acetyltransferase [Amino acid transpor	97.7
PRK14500		346	putative bifunctional molybdopterin-guanine dinucl	97.69
TIGR02353		695	NRPS_term_dom non-ribosomal peptide synthetase ter	97.59
COG0110		190	WbbJ Acetyltransferase (isoleucine patch superfami	97.55
KOG1460		407	consensus GDP-mannose pyrophosphorylase [Carbohydr	97.43
KOG4750		269	consensus Serine O-acetyltransferase [Amino acid t	97.4
COG0110		190	WbbJ Acetyltransferase (isoleucine patch superfami	97.34
cd03349		145	LbH_XAT Xenobiotic acyltransferase (XAT): The XAT	97.31
PLN02474		469	UTP--glucose-1-phosphate uridylyltransferase	97.24
KOG3121		184	consensus Dynactin, subunit p25 [Cytoskeleton]	97.2
PF00132		36	Hexapep: Bacterial transferase hexapeptide (six re	97.2
COG4801		277	Predicted acyltransferase [General function predic	97.18
COG4801		277	Predicted acyltransferase [General function predic	97.15
COG1861		241	SpsF Spore coat polysaccharide biosynthesis protei	97.06
TIGR03584		222	PseF pseudaminic acid CMP-transferase. The sequenc	97.04
KOG4750		269	consensus Serine O-acetyltransferase [Amino acid t	96.94
PRK13412		974	fkp bifunctional fucokinase/L-fucose-1-P-guanylylt	96.87
PF14602		34	Hexapep_2: Hexapeptide repeat of succinyl-transfer	96.78
cd00897		300	UGPase_euk Eukaryotic UGPase catalyses the synthes	96.46
KOG4042		190	consensus Dynactin subunit p27/WS-3, involved in t	96.3
PF02348		217	CTP_transf_3: Cytidylyltransferase; InterPro: IPR0	96.12
COG1083		228	NeuA CMP-N-acetylneuraminic acid synthetase [Cell	96.1
PF00132		36	Hexapep: Bacterial transferase hexapeptide (six re	96.0
cd06424		315	UGGPase UGGPase catalyzes the synthesis of UDP-Glu	95.66
PF01704		420	UDPGP: UTP--glucose-1-phosphate uridylyltransferas	95.58
PF14602		34	Hexapep_2: Hexapeptide repeat of succinyl-transfer	95.57
PLN02830		615	UDP-sugar pyrophosphorylase	94.73
COG4284		472	UDP-glucose pyrophosphorylase [Carbohydrate transp	94.51
PF07959		414	Fucokinase: L-fucokinase; InterPro: IPR012887 In t	93.23
PLN02435		493	probable UDP-N-acetylglucosamine pyrophosphorylase	92.68
PF07959		414	Fucokinase: L-fucokinase; InterPro: IPR012887 In t	92.54
PRK00576		178	molybdopterin-guanine dinucleotide biosynthesis pr	85.78

>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=3.5e-55  Score=430.74  Aligned_cols=297  Identities=41%  Similarity=0.738  Sum_probs=264.9

Q ss_pred             ccCceEEEEEcCCCCCCCCCCcCCCCCcceEeCCCcchHHHHHHhhhhCCCceEEEEcccChhhHHHHHHHHHH------
Q 015296           86 ASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAYA------  159 (409)
Q Consensus        86 ~~~~m~aIILAaG~GtRl~Plt~~~PK~LlPI~g~~pLI~~~l~~l~~~Gi~~I~Vv~~~~~~~i~~~l~~~~~------  159 (409)
                      +++++.|+|||||.|+||.|||+.||||.+|+||+|+|||++|+||.++||.+|+|+|+|++.++.+||+.+|.      
T Consensus         2 ~~~~~laiILaGg~G~rL~~LT~~RakpAVpFgGkYRiIDF~LSN~vNSGi~~I~VltQy~~~SL~~Hi~~G~~w~l~~~   81 (393)
T COG0448           2 MKKNVLAIILAGGRGSRLSPLTKDRAKPAVPFGGKYRIIDFALSNCVNSGIRRIGVLTQYKSHSLNDHIGRGWPWDLDRK   81 (393)
T ss_pred             CccceEEEEEcCCCCCccchhhhCccccccccCceeEEEeEEcccccccCCCeEEEEeccchhHHHHHhhCCCccccccc
Confidence            46788999999999999999999999999999999999999999999999999999999999999999998654      


Q ss_pred             ----------------------------------------------------------HHHHHcCCCeEEEEe-------
Q 015296          160 ----------------------------------------------------------KQLKAMKVDTTILGL-------  174 (409)
Q Consensus       160 ----------------------------------------------------------e~~~~~~~d~til~~-------  174 (409)
                                                                                ++|...++|.|+...       
T Consensus        82 ~~~v~ilp~~~~~~~~~wy~Gtadai~Qnl~~i~~~~~eyvlIlsgDhIYkmDy~~ml~~H~~~gadiTv~~~~Vp~~ea  161 (393)
T COG0448          82 NGGVFILPAQQREGGERWYEGTADAIYQNLLIIRRSDPEYVLILSGDHIYKMDYSDMLDFHIESGADVTVAVKEVPREEA  161 (393)
T ss_pred             cCcEEEeCchhccCCCcceeccHHHHHHhHHHHHhcCCCEEEEecCCEEEecCHHHHHHHHHHcCCCEEEEEEECChHhh
Confidence                                                                      567777888887653       


Q ss_pred             --------cCC----cccCCC-------cEEEEEEEEEeHHHHHHHHhhcCC---CCCcchhchHHHHHhCCCeEEEEEe
Q 015296          175 --------DDE----RAKEMP-------YIASMGIYVISKDVMLNLLRDKFP---GANDFGSEVIPGATSIGMRVQAYLY  232 (409)
Q Consensus       175 --------~~~----~~~ekp-------~~~~~Giyif~~~vl~~ll~~~~~---~~~d~~~dli~~ll~~g~~V~a~~~  232 (409)
                              +++    +|.|||       .+++||+|+|+++.|.++|.+...   +..||++++||.+++.|. ++||+|
T Consensus       162 s~fGim~~D~~~~i~~F~eKp~~~~~~~~laSMgiYIf~~~~L~~~L~~~~~~~~~~~DfgkdiIp~~~~~~~-v~AY~f  240 (393)
T COG0448         162 SRFGVMNVDENGRIIEFVEKPADGPPSNSLASMGIYIFNTDLLKELLEEDAKDPNSSHDFGKDIIPKLLERGK-VYAYEF  240 (393)
T ss_pred             hhcCceEECCCCCEEeeeeccCcCCcccceeeeeeEEEcHHHHHHHHHHHhcccCccccchHHHHHHHHhcCC-EEEEec
Confidence                    222    345555       269999999999999999886542   457899999999999775 999999


Q ss_pred             cCeEEEcCCHHHHHHHHHhhccCCCCCCcccCCCCCccCCCcccCCceEe-cceEEEEEECCCcEEcceEEeceEECCCC
Q 015296          233 DGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSKML-DADVTDSVIGEGCVIKNCKIHHSVVGLRS  311 (409)
Q Consensus       233 ~gyw~DIgt~edy~~an~~ll~~~~~~~~~~~~~~~i~~~~~~~~p~~i~-~~~i~~~~Ig~g~~I~~~~I~~svIg~~~  311 (409)
                      +|||.||||+++||+||+++++ +.|.+.+|+++.+||+....+||+++. ++++.+|.|++||+|.+ +|+||+|+.++
T Consensus       241 ~gYw~dVgTi~syy~aNmdLl~-~~~~~~lyd~~w~IyT~~~~~pPak~~~~s~v~nSLv~~GciI~G-~V~nSVL~~~v  318 (393)
T COG0448         241 SGYWRDVGTIDSYYEANMDLLS-PQPELNLYDRNWPIYTKNKNLPPAKFVNDSEVSNSLVAGGCIISG-TVENSVLFRGV  318 (393)
T ss_pred             cchhhhcccHHHHHHhhHHhcC-CCCcccccCCCCceeecCCCCCCceEecCceEeeeeeeCCeEEEe-EEEeeEEecCe
Confidence            9999999999999999999999 446788999999999999999999999 78889999999999999 99999999999


Q ss_pred             EECCCCEEeceEEeCCcccccccchhhhccCCCcceEeCCCCEEcceEeCCCCEECCCcEEeCCCccCCceeecCCeEEe
Q 015296          312 CISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIK  391 (409)
Q Consensus       312 ~Ig~~~~I~~s~i~~~~~~~~~~~~~~~~~~g~~~v~Ig~~~~I~~~ii~~n~~IG~~~~i~~~~~v~~~~~~~~g~~i~  391 (409)
                      +|+.+|.|++|+||++                   +.||+||+|++||||+||.|++|+.|.+..  ++.++.. +.+. 
T Consensus       319 ~I~~gs~i~~svim~~-------------------~~IG~~~~l~~aIIDk~v~I~~g~~i~~~~--~~~d~~~-~~~~-  375 (393)
T COG0448         319 RIGKGSVIENSVIMPD-------------------VEIGEGAVLRRAIIDKNVVIGEGVVIGGDK--PEEDRKR-FRSE-  375 (393)
T ss_pred             EECCCCEEEeeEEeCC-------------------cEECCCCEEEEEEeCCCcEeCCCcEEcCCc--chhcccc-cccc-
Confidence            9999999999999998                   579999999999999999999999998876  5555655 5666 


Q ss_pred             CCeEEEcCCcEeCCCcc
Q 015296          392 SGIVTIIKDALIPSGTI  408 (409)
Q Consensus       392 ~g~v~i~~~~~Ip~gtv  408 (409)
                      +|+++|+++.+++.+..
T Consensus       376 ~~ivVv~k~~~~~~~~~  392 (393)
T COG0448         376 EGIVVVPKGMVIKLDIM  392 (393)
T ss_pred             CCcEEEecccEeccccc
Confidence            99899999999987654

>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PLN02241 glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>TIGR02091 glgC glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry	Back alignment and domain information

>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit	Back alignment and domain information

>PRK10122 GalU regulator GalF; Provisional	Back alignment and domain information

>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins	Back alignment and domain information

>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose	Back alignment and domain information

>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional	Back alignment and domain information

>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase	Back alignment and domain information

>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase	Back alignment and domain information

>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase	Back alignment and domain information

>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase	Back alignment and domain information

>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family	Back alignment and domain information

>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form	Back alignment and domain information

>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional	Back alignment and domain information

>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose	Back alignment and domain information

>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family	Back alignment and domain information

>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases	Back alignment and domain information

>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch	Back alignment and domain information

>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline	Back alignment and domain information

>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars	Back alignment and domain information

>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule	Back alignment and domain information

>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose	Back alignment and domain information

>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU	Back alignment and domain information

>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional	Back alignment and domain information

>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	Back alignment and domain information

>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide	Back alignment and domain information

>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional	Back alignment and domain information

>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	Back alignment and domain information

>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains	Back alignment and domain information

>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional	Back alignment and domain information

>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity	Back alignment and domain information

>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2	Back alignment and domain information

>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc	Back alignment and domain information

>PLN02296 carbonate dehydratase	Back alignment and domain information

>TIGR02287 PaaY phenylacetic acid degradation protein PaaY	Back alignment and domain information

>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase	Back alignment and domain information

>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E	Back alignment and domain information

>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	Back alignment and domain information

>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family	Back alignment and domain information

>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl]	Back alignment and domain information

>PLN02472 uncharacterized protein	Back alignment and domain information

>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains	Back alignment and domain information

>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional	Back alignment and domain information

>PRK13627 carnitine operon protein CaiE; Provisional	Back alignment and domain information

>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed	Back alignment and domain information

>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	Back alignment and domain information

>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional	Back alignment and domain information

>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc	Back alignment and domain information

>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>COG1043 LpxA Acyl-[acyl carrier protein]	Back alignment and domain information

>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition	Back alignment and domain information

>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional	Back alignment and domain information

>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site

Back alignment and domain information

>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional	Back alignment and domain information

>COG1043 LpxA Acyl-[acyl carrier protein]	Back alignment and domain information

>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E	Back alignment and domain information

>PLN02917 CMP-KDO synthetase	Back alignment and domain information

>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism]	Back alignment and domain information

>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family	Back alignment and domain information

>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E	Back alignment and domain information

>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	Back alignment and domain information

>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain	Back alignment and domain information

>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]	Back alignment and domain information

>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase	Back alignment and domain information

>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR00454 conserved hypothetical protein TIGR00454	Back alignment and domain information

>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production	Back alignment and domain information

>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PLN02296 carbonate dehydratase	Back alignment and domain information

>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA	Back alignment and domain information

>PRK13627 carnitine operon protein CaiE; Provisional	Back alignment and domain information

>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	Back alignment and domain information

>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family	Back alignment and domain information

>TIGR02287 PaaY phenylacetic acid degradation protein PaaY	Back alignment and domain information

>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E	Back alignment and domain information

>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain	Back alignment and domain information

>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed	Back alignment and domain information

>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional	Back alignment and domain information

>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional	Back alignment and domain information

>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma	Back alignment and domain information

>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase	Back alignment and domain information

>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>COG2068 Uncharacterized MobA-related protein [General function prediction only]	Back alignment and domain information

>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	Back alignment and domain information

>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition	Back alignment and domain information

>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional	Back alignment and domain information

>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA	Back alignment and domain information

>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase	Back alignment and domain information

>PLN02472 uncharacterized protein	Back alignment and domain information

>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon)	Back alignment and domain information

Back alignment and domain information

>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain	Back alignment and domain information

>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain	Back alignment and domain information

>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase	Back alignment and domain information

>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family	Back alignment and domain information

>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide	Back alignment and domain information

>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]	Back alignment and domain information

>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function	Back alignment and domain information

>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B	Back alignment and domain information

>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>PLN02694 serine O-acetyltransferase	Back alignment and domain information

>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH	Back alignment and domain information

>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat	Back alignment and domain information

>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH	Back alignment and domain information

>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins	Back alignment and domain information

>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety	Back alignment and domain information

>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional	Back alignment and domain information

>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism]	Back alignment and domain information

>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport	Back alignment and domain information

>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>TIGR01172 cysE serine O-acetyltransferase	Back alignment and domain information

>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form	Back alignment and domain information

>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit	Back alignment and domain information

>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton]	Back alignment and domain information

>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PRK10502 putative acyl transferase; Provisional	Back alignment and domain information

>PRK11132 cysE serine acetyltransferase; Provisional	Back alignment and domain information

>PRK10502 putative acyl transferase; Provisional	Back alignment and domain information

>PRK10092 maltose O-acetyltransferase; Provisional	Back alignment and domain information

>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates	Back alignment and domain information

>PLN02357 serine acetyltransferase	Back alignment and domain information

>PRK09527 lacA galactoside O-acetyltransferase; Reviewed	Back alignment and domain information

>PLN02241 glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB	Back alignment and domain information

>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional	Back alignment and domain information

>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine	Back alignment and domain information

>TIGR02091 glgC glucose-1-phosphate adenylyltransferase	Back alignment and domain information

>PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate []	Back alignment and domain information

>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional	Back alignment and domain information

>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates	Back alignment and domain information

>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial	Back alignment and domain information

>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional	Back alignment and domain information

>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes	Back alignment and domain information

>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional	Back alignment and domain information

>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01172 cysE serine O-acetyltransferase	Back alignment and domain information

>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E	Back alignment and domain information

>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>PRK11132 cysE serine acetyltransferase; Provisional	Back alignment and domain information

>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine	Back alignment and domain information

>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X)	Back alignment and domain information

>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	Back alignment and domain information

>PRK09527 lacA galactoside O-acetyltransferase; Reviewed	Back alignment and domain information

>PLN02694 serine O-acetyltransferase	Back alignment and domain information

>PRK10092 maltose O-acetyltransferase; Provisional	Back alignment and domain information

>PRK10191 putative acyl transferase; Provisional	Back alignment and domain information

>PLN02739 serine acetyltransferase	Back alignment and domain information

>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc	Back alignment and domain information

>PRK10191 putative acyl transferase; Provisional	Back alignment and domain information

>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E	Back alignment and domain information

>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02357 serine acetyltransferase	Back alignment and domain information

>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others	Back alignment and domain information

>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional	Back alignment and domain information

>PLN02739 serine acetyltransferase	Back alignment and domain information

>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism]	Back alignment and domain information

>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins	Back alignment and domain information

>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function	Back alignment and domain information

>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional	Back alignment and domain information

>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function	Back alignment and domain information

>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only]	Back alignment and domain information

>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only]	Back alignment and domain information

>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others	Back alignment and domain information

>PLN02474 UTP--glucose-1-phosphate uridylyltransferase	Back alignment and domain information

>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton]	Back alignment and domain information

>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix	Back alignment and domain information

>COG4801 Predicted acyltransferase [General function prediction only]	Back alignment and domain information

>COG4801 Predicted acyltransferase [General function prediction only]	Back alignment and domain information

>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR03584 PseF pseudaminic acid CMP-transferase	Back alignment and domain information

>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional	Back alignment and domain information

>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A	Back alignment and domain information

>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose	Back alignment and domain information

>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]	Back alignment and domain information

>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2	Back alignment and domain information

>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix	Back alignment and domain information

>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose	Back alignment and domain information

>PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2	Back alignment and domain information

>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A	Back alignment and domain information

>PLN02830 UDP-sugar pyrophosphorylase	Back alignment and domain information

>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase []	Back alignment and domain information

>PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase	Back alignment and domain information

>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase []	Back alignment and domain information

>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		409
1yp2_A		451	Crystal Structure Of Potato Tuber Adp-Glucose Pyrop		1e-140
3brk_X		420	Crystal Structure Of Adp-Glucose Pyrophosphorylase		4e-13
3brk_X		420	Crystal Structure Of Adp-Glucose Pyrophosphorylase		4e-12

>pdb|1YP2|A Chain A, Crystal Structure Of Potato Tuber Adp-Glucose Pyrophosphorylase Length = 451

Back alignment and structure

Iteration: 1

Score = 495 bits (1274), Expect = e-140, Method: Compositional matrix adjust. Identities = 235/250 (94%), Positives = 246/250 (98%) Query: 160 KQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG 219 +QL+AMKVDTTILGLDD+RAKEMP+IASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG Sbjct: 202 EQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG 261 Query: 220 ATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPS 279 ATS+GMRVQAYLYDGYWEDIGTIEAFYNANLGITKKP+PDFSFYDRSAPIYTQPRYLPPS Sbjct: 262 ATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPS 321 Query: 280 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFL 339 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIED+LLMGADYYETDADR+ L Sbjct: 322 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLL 381 Query: 340 AAKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIK 399 AAKGSVPIGIGKN HIKRAIIDKNARIGDNVKI+N D+VQEAARETDGYFIKSGIVT+IK Sbjct: 382 AAKGSVPIGIGKNCHIKRAIIDKNARIGDNVKIINKDNVQEAARETDGYFIKSGIVTVIK 441 Query: 400 DALIPSGTII 409 DALIPSG II Sbjct: 442 DALIPSGIII 451

PyMOL of 1yp2

>pdb|3BRK|X Chain X, Crystal Structure Of Adp-Glucose Pyrophosphorylase From Agrobacterium Tumefaciens Length = 420

Back alignment and structure

>pdb|3BRK|X Chain X, Crystal Structure Of Adp-Glucose Pyrophosphorylase From Agrobacterium Tumefaciens Length = 420

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		409
1yp2_A		451	Glucose-1-phosphate adenylyltransferase small subu	1e-124
1yp2_A		451	Glucose-1-phosphate adenylyltransferase small subu	4e-49
3brk_X		420	Glucose-1-phosphate adenylyltransferase; ADP-gluco	7e-76
3brk_X		420	Glucose-1-phosphate adenylyltransferase; ADP-gluco	4e-38
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-04
1jyk_A		254	LICC protein, CTP:phosphocholine cytidylytransfera	2e-07
2ggo_A		401	401AA long hypothetical glucose-1-phosphate thymid	6e-06
2ggo_A		401	401AA long hypothetical glucose-1-phosphate thymid	4e-04
2xme_A		232	CTP-inositol-1-phosphate cytidylyltransferase; CDP	8e-06
2iu8_A		374	LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a	2e-05
3rsb_A		196	Adenosylcobinamide-phosphate guanylyltransferase;	2e-05
3pmo_A		372	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr;	2e-05
3eh0_A		341	UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr	2e-05
1lvw_A		295	Glucose-1-phosphate thymidylyltransferase; protein	7e-05
4ecm_A		269	Glucose-1-phosphate thymidylyltransferase; HET: DA	7e-05
1fxo_A		293	Glucose-1-phosphate thymidylyltransferase; rhamnos	8e-05
1mc3_A		296	Glucose-1-phosphate thymidylyltransferase; glucose	8e-05
3fs8_A		273	QDTC; acetyltransferase, natural product, deoxysug	1e-04
4evw_A		255	Nucleoside-diphosphate-sugar pyrophosphorylase; st	6e-04

>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451	Back alignment and structure

 Score =  367 bits (944), Expect = e-124
 Identities = 235/249 (94%), Positives = 245/249 (98%)

Query: 161 QLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGA 220
           QL+AMKVDTTILGLDD+RAKEMP+IASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGA
Sbjct: 203 QLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGA 262

Query: 221 TSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPSK 280
           TS+GMRVQAYLYDGYWEDIGTIEAFYNANLGITKKP+PDFSFYDRSAPIYTQPRYLPPSK
Sbjct: 263 TSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPSK 322

Query: 281 MLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLA 340
           MLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIED+LLMGADYYETDADR+ LA
Sbjct: 323 MLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLA 382

Query: 341 AKGSVPIGIGKNSHIKRAIIDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKD 400
           AKGSVPIGIGKN HIKRAIIDKNARIGDNVKI+N D+VQEAARETDGYFIKSGIVT+IKD
Sbjct: 383 AKGSVPIGIGKNCHIKRAIIDKNARIGDNVKIINKDNVQEAARETDGYFIKSGIVTVIKD 442

Query: 401 ALIPSGTII 409
           ALIPSG II
Sbjct: 443 ALIPSGIII 451

PyMOL of 1yp2

>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451	Back alignment and structure

>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420	Back alignment and structure

>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254	Back alignment and structure

>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401	Back alignment and structure

>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401	Back alignment and structure

>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232	Back alignment and structure

>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374	Back alignment and structure

>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196	Back alignment and structure

>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372	Back alignment and structure

>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341	Back alignment and structure

>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Length = 295	Back alignment and structure

>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Length = 269	Back alignment and structure

>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Length = 293	Back alignment and structure

>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Length = 296	Back alignment and structure

>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273	Back alignment and structure

>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Length = 255	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		409
1yp2_A		451	Glucose-1-phosphate adenylyltransferase small subu	100.0
3brk_X		420	Glucose-1-phosphate adenylyltransferase; ADP-gluco	100.0
2ggo_A		401	401AA long hypothetical glucose-1-phosphate thymid	100.0
3st8_A		501	Bifunctional protein GLMU; acetyltransferase, pyro	100.0
1hm9_A		468	GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr	100.0
4fce_A		459	Bifunctional protein GLMU; GLMU. csgid, niaid, str	100.0
2v0h_A		456	Bifunctional protein GLMU; cell WALL, magnesium, c	100.0
4ecm_A		269	Glucose-1-phosphate thymidylyltransferase; HET: DA	99.9
3juk_A		281	UDP-glucose pyrophosphorylase (GALU); transfer; HE	99.9
1tzf_A		259	Glucose-1-phosphate cytidylyltransferase; nucleoti	99.89
2e3d_A		302	UTP--glucose-1-phosphate uridylyltransferase; UDP-	99.87
2ux8_A		297	Glucose-1-phosphate uridylyltransferase; UGPG, GAL	99.86
2pa4_A		323	UTP-glucose-1-phosphate uridylyltransferase; phosp	99.85
4evw_A		255	Nucleoside-diphosphate-sugar pyrophosphorylase; st	99.84
1fxo_A		293	Glucose-1-phosphate thymidylyltransferase; rhamnos	99.82
3pnn_A		303	Conserved domain protein; structural genomics, PSI	99.82
2qh5_A		308	PMI, ALGA, mannose-6-phosphate isomerase; structur	99.82
1lvw_A		295	Glucose-1-phosphate thymidylyltransferase; protein	99.82
1mc3_A		296	Glucose-1-phosphate thymidylyltransferase; glucose	99.81
2x65_A		336	Mannose-1-phosphate guanylyltransferase; nucleotid	99.81
1jyk_A		254	LICC protein, CTP:phosphocholine cytidylytransfera	99.8
2cu2_A		337	Putative mannose-1-phosphate guanylyl transferase;	99.75
3oam_A		252	3-deoxy-manno-octulosonate cytidylyltransferase; c	99.71
3tqd_A		256	3-deoxy-manno-octulosonate cytidylyltransferase; c	99.66
1h7e_A		245	3-deoxy-manno-octulosonate cytidylyltransferase; n	99.65
2iu8_A		374	LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a	99.64
2y6p_A		234	3-deoxy-manno-octulosonate cytidylyltransferase; l	99.64
3k8d_A		264	3-deoxy-manno-octulosonate cytidylyltransferase; K	99.61
3f1c_A		246	Putative 2-C-methyl-D-erythritol 4-phosphate cytid	99.61
2xme_A		232	CTP-inositol-1-phosphate cytidylyltransferase; CDP	99.6
2vsh_A		236	TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly	99.59
1vic_A		262	3-deoxy-manno-octulosonate cytidylyltransferase; s	99.59
4fcu_A		253	3-deoxy-manno-octulosonate cytidylyltransferase; s	99.58
2yc3_A		228	2-C-methyl-D-erythritol 4-phosphate cytidylyltran	99.57
4eqy_A		283	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.54
1j2z_A		270	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.54
2xwl_A		223	2-C-methyl-D-erythritol 4-phosphate cytidylyltran;	99.53
3r0s_A		266	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.52
4e79_A		357	UDP-3-O-acylglucosamine N-acyltransferase; lipopol	99.51
3eh0_A		341	UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr	99.51
3hsq_A		259	Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam	99.5
1qre_A		247	Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth	99.49
3pmo_A		372	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr;	99.49
4e6u_A		265	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.48
1vgw_A		231	4-diphosphocytidyl-2C-methyl-D-erythritol synthas;	99.47
2qia_A		262	UDP-N-acetylglucosamine acyltransferase; LEFT-hand	99.46
2waw_A		199	MOBA relate protein; unknown function; HET: PGE; 1	99.45
2wee_A		197	MOBA-related protein; unknown function; 1.65A {Myc	99.44
3bfp_A		194	Acetyltransferase; LEFT-handed beta helix, COA bin	99.43
1v3w_A		173	Ferripyochelin binding protein; beta-helix, carbon	99.43
3t57_A		305	UDP-N-acetylglucosamine O-acyltransferase domain-	99.43
3r3r_A		187	Ferripyochelin binding protein; structural genomic	99.42
1xhd_A		173	Putative acetyltransferase/acyltransferase; struct	99.42
3tv0_A		194	Dynactin subunit 6; LEFT-handed beta-helix, ARP11,	99.41
3r8y_A		240	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac	99.4
3ixc_A		191	Hexapeptide transferase family protein; niaid, ssg	99.4
3pmo_A		372	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr;	99.4
2dpw_A		232	Hypothetical protein TTHA0179; transferase, struct	99.4
1i52_A		236	4-diphosphocytidyl-2-C-methylerythritol synthase;	99.4
3kwd_A		213	Carbon dioxide concentrating mechanism protein; LE	99.39
3fs8_A		273	QDTC; acetyltransferase, natural product, deoxysug	99.38
3rsb_A		196	Adenosylcobinamide-phosphate guanylyltransferase;	99.38
3eh0_A		341	UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr	99.38
4eqy_A		283	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.37
4e79_A		357	UDP-3-O-acylglucosamine N-acyltransferase; lipopol	99.37
3r0s_A		266	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.37
3tk8_A		316	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.36
3r1w_A		189	Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid	99.35
1ezi_A		228	CMP-N-acetylneuraminic acid synthetase; homodimer,	99.35
3gos_A		276	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.35
4e6u_A		265	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.35
1vpa_A		234	2-C-methyl-D-erythritol 4-phosphate cytidylyltran;	99.33
3hsq_A		259	Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam	99.33
3c8v_A		496	Putative acetyltransferase; YP_390128.1, structura	99.33
1hm9_A		468	GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr	99.31
3mqg_A		192	Lipopolysaccharides biosynthesis acetyltransferas;	99.31
3fs8_A		273	QDTC; acetyltransferase, natural product, deoxysug	99.3
1qwj_A		229	Cytidine monophospho-N-acetylneuraminic acid synth	99.3
2qia_A		262	UDP-N-acetylglucosamine acyltransferase; LEFT-hand	99.3
1j2z_A		270	Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam	99.3
3ixc_A		191	Hexapeptide transferase family protein; niaid, ssg	99.29
2pig_A		334	Putative transferase; SCR6, NESG, YDCK, structural	99.29
2e8b_A		201	Probable molybdopterin-guanine dinucleotide biosy	99.27
3t57_A		305	UDP-N-acetylglucosamine O-acyltransferase domain-	99.27
2px7_A		236	2-C-methyl-D-erythritol 4-phosphate cytidylyltrans	99.26
2icy_A		469	Probable UTP-glucose-1-phosphate uridylyltransfera	99.26
1xhd_A		173	Putative acetyltransferase/acyltransferase; struct	99.25
3eg4_A		304	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.25
2v0h_A		456	Bifunctional protein GLMU; cell WALL, magnesium, c	99.24
3r3r_A		187	Ferripyochelin binding protein; structural genomic	99.23
3vbi_A		205	ANTD, galactoside O-acetyltransferase; anthrose, a	99.23
3r1w_A		189	Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid	99.21
3tv0_A		194	Dynactin subunit 6; LEFT-handed beta-helix, ARP11,	99.21
4ea9_A		220	Perosamine N-acetyltransferase; beta helix, acetyl	99.21
2ggo_A		401	401AA long hypothetical glucose-1-phosphate thymid	99.21
3vbi_A		205	ANTD, galactoside O-acetyltransferase; anthrose, a	99.2
1v3w_A		173	Ferripyochelin binding protein; beta-helix, carbon	99.17
3jqy_B		252	NEUO, polysialic acid O-acetyltransferase; LEFT-ha	99.17
2iu8_A		374	LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a	99.17
3mqg_A		192	Lipopolysaccharides biosynthesis acetyltransferas;	99.16
3q80_A		231	2-C-methyl-D-erythritol 4-phosphate cytidyltransf;	99.16
4fce_A		459	Bifunctional protein GLMU; GLMU. csgid, niaid, str	99.16
3kwd_A		213	Carbon dioxide concentrating mechanism protein; LE	99.16
2pig_A		334	Putative transferase; SCR6, NESG, YDCK, structural	99.13
3d5n_A		197	Q97W15_sulso; NESG, SSR125, structural genomics, P	99.13
3r8y_A		240	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac	99.12
1qre_A		247	Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth	99.1
3jqy_B		252	NEUO, polysialic acid O-acetyltransferase; LEFT-ha	99.08
4ea9_A		220	Perosamine N-acetyltransferase; beta helix, acetyl	99.07
3eg4_A		304	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.05
1w55_A		371	ISPD/ISPF bifunctional enzyme; biosynthetic pathwa	99.05
3c8v_A		496	Putative acetyltransferase; YP_390128.1, structura	99.03
3tk8_A		316	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.02
3bfp_A		194	Acetyltransferase; LEFT-handed beta helix, COA bin	99.02
3gos_A		276	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su	99.0
2wlg_A		215	Polysialic acid O-acetyltransferase; enzyme, LEFT-	98.98
3r5d_A		347	Tetrahydrodipicolinate N-succinyletransferase; 1.8	98.94
2wlg_A		215	Polysialic acid O-acetyltransferase; enzyme, LEFT-	98.92
3fsy_A		332	Tetrahydrodipicolinate N-succinyltransferase; beta	98.91
2rij_A		387	Putative 2,3,4,5-tetrahydropyridine-2-carboxylate	98.9
3nz2_A		195	Hexapeptide-repeat containing-acetyltransferase; s	98.87
3ngw_A		208	Molybdopterin-guanine dinucleotide biosynthesis P	98.87
3fsy_A		332	Tetrahydrodipicolinate N-succinyltransferase; beta	98.87
3st8_A		501	Bifunctional protein GLMU; acetyltransferase, pyro	98.86
3ftt_A		199	Putative acetyltransferase sacol2570; galactoside	98.84
3r5d_A		347	Tetrahydrodipicolinate N-succinyletransferase; 1.8	98.83
1e5k_A		201	Molybdopterin-guanine dinucleotide biosynthesis pr	98.83
3hjj_A		190	Maltose O-acetyltransferase; LEFT-handed beta-heli	98.83
3srt_A		188	Maltose O-acetyltransferase; structural genomics,	98.83
3q1x_A		313	Serine acetyltransferase; cysteine biosynthesis, L	98.78
1krr_A		203	Galactoside O-acetyltransferase; LEFT-handed paral	98.75
3nz2_A		195	Hexapeptide-repeat containing-acetyltransferase; s	98.7
1yp2_A		451	Glucose-1-phosphate adenylyltransferase small subu	98.69
4hur_A		220	Virginiamycin A acetyltransferase; structural geno	98.68
3hjj_A		190	Maltose O-acetyltransferase; LEFT-handed beta-heli	98.67
4hur_A		220	Virginiamycin A acetyltransferase; structural geno	98.66
2p2o_A		185	Maltose transacetylase; GK1921, GKA001001921.1, ge	98.66
3srt_A		188	Maltose O-acetyltransferase; structural genomics,	98.66
3ftt_A		199	Putative acetyltransferase sacol2570; galactoside	98.65
1krr_A		203	Galactoside O-acetyltransferase; LEFT-handed paral	98.65
3brk_X		420	Glucose-1-phosphate adenylyltransferase; ADP-gluco	98.64
3mc4_A		287	WW/RSP5/WWP domain:bacterial transferase hexapept	98.64
1ocx_A		182	Maltose O-acetyltransferase; LEFT-handed parallel	98.6
3q1x_A		313	Serine acetyltransferase; cysteine biosynthesis, L	98.6
3f1x_A		310	Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9	98.59
2p2o_A		185	Maltose transacetylase; GK1921, GKA001001921.1, ge	98.57
1ssq_A		267	SAT, serine acetyltransferase; LEFT-handed paralle	98.54
3mc4_A		287	WW/RSP5/WWP domain:bacterial transferase hexapept	98.53
1ocx_A		182	Maltose O-acetyltransferase; LEFT-handed parallel	98.5
1t3d_A		289	SAT, serine acetyltransferase; LEFT-handed-beta-he	98.49
3f1x_A		310	Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9	98.47
1ssq_A		267	SAT, serine acetyltransferase; LEFT-handed paralle	98.43
1t3d_A		289	SAT, serine acetyltransferase; LEFT-handed-beta-he	98.39
2rij_A		387	Putative 2,3,4,5-tetrahydropyridine-2-carboxylate	98.38
2i5k_A		488	UTP--glucose-1-phosphate uridylyltransferase; LEFT	98.34
3eev_A		212	Chloramphenicol acetyltransferase; beta-helix, str	98.3
2oeg_A		505	UTP-glucose-1-phosphate uridylyltransferase 2, put	98.27
1jv1_A		505	Glcnac1P uridyltransferase isoform 1: AGX1; nucleo	98.23
3eev_A		212	Chloramphenicol acetyltransferase; beta-helix, str	98.22
2yqc_A		486	UDP-N-acetylglucosamine pyrophosphorylase; uridine	98.2
4e8l_A		219	Virginiamycin A acetyltransferase; structural geno	98.16
1mr7_A		209	Streptogramin A acetyltransferase; LEFT-handed par	98.08
1xat_A		212	Xenobiotic acetyltransferase; chloramphenicol, LEF	98.04
3oc9_A		405	UDP-N-acetylglucosamine pyrophosphorylase; structu	97.97
1xat_A		212	Xenobiotic acetyltransferase; chloramphenicol, LEF	97.95
4e8l_A		219	Virginiamycin A acetyltransferase; structural geno	97.93
1mr7_A		209	Streptogramin A acetyltransferase; LEFT-handed par	97.91
3r3i_A		528	UTP--glucose-1-phosphate uridylyltransferase; ross	96.13
3gue_A		484	UTP-glucose-1-phosphate uridylyltransferase 2; pho	95.21
3ogz_A		630	UDP-sugar pyrophosphorylase; LEFT handed beta heli	94.25
2i5e_A		211	Hypothetical protein MM_2497; APC86122, methanosar	91.11

>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A*	Back alignment and structure

Probab=100.00  E-value=7.1e-49  Score=403.11  Aligned_cols=339  Identities=90%  Similarity=1.372  Sum_probs=273.7

Q ss_pred             cccccccccccCCccccCceEEEEEcCCCCCCCCCCcCCCCCcceEeCCCcchHHHHHHhhhhCCCceEEEEcccChhhH
Q 015296           71 AVSDSKNSQTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASL  150 (409)
Q Consensus        71 ~~~~~~~~~~~~~~~~~~~m~aIILAaG~GtRl~Plt~~~PK~LlPI~g~~pLI~~~l~~l~~~Gi~~I~Vv~~~~~~~i  150 (409)
                      +++++++..+|+++..|+.|+|||||||.||||+|||..+||+|+|++|++|||+|+|++|.++|+++|+|+++++.+++
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~avILAaG~gtRl~plT~~~pK~llpi~g~~pli~~~l~~l~~~g~~~i~vv~~~~~~~i   81 (451)
T 1yp2_A            2 AVSDSQNSQTCLDPDASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASL   81 (451)
T ss_dssp             --------CCCCSSCHHHHEEEEEC------CCTTTTTTSCGGGCEETTTEETTHHHHHHHHHTTCCEEEEEESCCCHHH
T ss_pred             ccccccccceecCcccccceEEEEECCCCCCcccchhcCCcceeeEECCcceeHHHHHHHHHHCCCCEEEEEeccCHHHH
Confidence            45778889999999988899999999999999999999999999999985599999999999999999999999988777


Q ss_pred             HHHHHHHH---------------------------H---------------------------------------HHHHH
Q 015296          151 NRHLSRAY---------------------------A---------------------------------------KQLKA  164 (409)
Q Consensus       151 ~~~l~~~~---------------------------~---------------------------------------e~~~~  164 (409)
                      .+|+.+.|                           .                                       +.|..
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~v~i~~~~~~~~~~~~~~Gt~~al~~a~~~~~~~~~~~~lv~~~D~~~~~~l~~l~~~~~~  161 (451)
T 1yp2_A           82 NRHLSRAYASNMGGYKNEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRE  161 (451)
T ss_dssp             HHHHHHHCC--------CCEEEEEESCSSTTSCCCCCSHHHHHHHTHHHHTTSCCSEEEEECSCEECCCCHHHHHHHHHH
T ss_pred             HHHHhhhhhcccccccccCcEEEecccccccccccccCcHHHHHHHHHHHHhcCCCeEEEecCcEEEcCCHHHHHHHHHH
Confidence            76654311                           0                                       22222


Q ss_pred             cCCCeEEEE---------------ecCC----cccCCC--------------------------cEEEEEEEEEeHHHHH
Q 015296          165 MKVDTTILG---------------LDDE----RAKEMP--------------------------YIASMGIYVISKDVML  199 (409)
Q Consensus       165 ~~~d~til~---------------~~~~----~~~ekp--------------------------~~~~~Giyif~~~vl~  199 (409)
                      .+.+.+++.               ++++    .+.|||                          +++++|+|+|++++|.
T Consensus       162 ~~~~~tl~~~~~~~~~~~~~g~v~~d~~~~v~~~~ekp~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Giy~~~~~~l~  241 (451)
T 1yp2_A          162 TDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVML  241 (451)
T ss_dssp             TTCSEEEEEEEECHHHHTTSEEEEECTTSBEEEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHHH
T ss_pred             cCCcEEEEEEEcChhhcccCCEEEECCCCCEEEEEECCCchhhccccccccccccccccccCCcceEEeeEEEEcHHHHH
Confidence            233444321               1211    123444                          4789999999999987


Q ss_pred             HHHhhcCCCCCcchhchHHHHHhCCCeEEEEEecCeEEEcCCHHHHHHHHHhhccCCCCCCcccCCCCCccCCCcccCCc
Q 015296          200 NLLRDKFPGANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPRYLPPS  279 (409)
Q Consensus       200 ~ll~~~~~~~~d~~~dli~~ll~~g~~V~a~~~~gyw~DIgt~edy~~an~~ll~~~~~~~~~~~~~~~i~~~~~~~~p~  279 (409)
                      .+++..++...+|.+++++.++++|.++.+|.+++||.|+||+++|+++++.++.+..+...++++.+.+++.+.+.|++
T Consensus       242 ~~l~~~~~~~~~~~~~~l~~~i~~g~~v~~~~~~~~w~digt~~~l~~a~~~l~~~~~~~~~~~~~~~~i~~~~~i~~~~  321 (451)
T 1yp2_A          242 NLLRDKFPGANDFGSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPS  321 (451)
T ss_dssp             HHHHTTCTTCCCTTTTHHHHHHHTTCCEEEEECCSCCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCCCCCCCE
T ss_pred             HHHHhhcccccchHhhHHHHHHhcCCceEEEEeCCEEEECCCHHHHHHHHHHHhcccccchhccCCCCeeccCCccCCCe
Confidence            67765544445677899999998888999999999999999999999999999877655677899999999999999999


Q ss_pred             eEecceEEEEEECCCcEEcceEEeceEECCCCEECCCCEEeceEEeCCcccccccchhhhccCCCcceEeCCCCEEcceE
Q 015296          280 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDTLLMGADYYETDADRRFLAAKGSVPIGIGKNSHIKRAI  359 (409)
Q Consensus       280 ~i~~~~i~~~~Ig~g~~I~~~~I~~svIg~~~~Ig~~~~I~~s~i~~~~~~~~~~~~~~~~~~g~~~v~Ig~~~~I~~~i  359 (409)
                      .+.++.|.++.||++|+|++|.|.+++||++|.||++|.|++++++++++++....+....+.|.+.+.||+++.|.+++
T Consensus       322 ~i~~~~I~~~~Ig~~~~I~~~~i~~~~Ig~~~~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~~~~Ig~~~~i~~~~  401 (451)
T 1yp2_A          322 KMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIKRAI  401 (451)
T ss_dssp             EEEEEEEEEEEECTTCEEEEEEEESCEECTTCEECTTCEEESCEECCCSSCCCHHHHHHHHTTTCCCSEECTTCEEESEE
T ss_pred             EEcceEEeCeEECCCCEEcceEEeccEECCCCEECCCCEEcCceEECCCCcccccccccccccCceeEEECCCCEEeccE
Confidence            99888888999999999998888899999999999999999999999877665554444555565546899999999999


Q ss_pred             eCCCCEECCCcEEeCCCccCCceeecCCeEEeCCeEEEcCCcEeCCCccC
Q 015296          360 IDKNARIGDNVKIVNSDSVQEAARETDGYFIKSGIVTIIKDALIPSGTII  409 (409)
Q Consensus       360 i~~n~~IG~~~~i~~~~~v~~~~~~~~g~~i~~g~v~i~~~~~Ip~gtvi  409 (409)
                      ||+||.||++++|.+.+++....++|++++|++|.|+|+++++|++||+|
T Consensus       402 Ig~~~~IG~~~~i~~~~~~~~~~~ig~~~~ig~~~v~Ig~~a~i~agsvv  451 (451)
T 1yp2_A          402 IDKNARIGDNVKIINKDNVQEAARETDGYFIKSGIVTVIKDALIPSGIII  451 (451)
T ss_dssp             ECTTCEECTTCEECCSSCCSCEEEGGGTEEEETTEEEECTTCEECTTCBC
T ss_pred             eCCCcEECCCCEEeCCcccccCceeCCCEEEcCCEEEECCCcEECCCccC
Confidence            99999999999999999998888999999999998899999999999986

PyMOL of 1yp2

>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens}	Back alignment and structure

>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A*	Back alignment and structure

>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A*	Back alignment and structure

>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A*	Back alignment and structure

>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A*	Back alignment and structure

>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A*	Back alignment and structure

>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A*	Back alignment and structure

>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A*	Back alignment and structure

>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A*	Back alignment and structure

>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli}	Back alignment and structure

>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea}	Back alignment and structure

>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae}	Back alignment and structure

>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ...	Back alignment and structure

>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis}	Back alignment and structure

>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori}	Back alignment and structure

>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6	Back alignment and structure

>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6	Back alignment and structure

>2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A*	Back alignment and structure

>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A*	Back alignment and structure

>2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20	Back alignment and structure

>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13	Back alignment and structure

>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0	Back alignment and structure

>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A*	Back alignment and structure

>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A*	Back alignment and structure

>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus}	Back alignment and structure

>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A*	Back alignment and structure

>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0	Back alignment and structure

>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A*	Back alignment and structure

>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A*	Back alignment and structure

>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A*	Back alignment and structure

>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A	Back alignment and structure

>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A*	Back alignment and structure

>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis}	Back alignment and structure

>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1	Back alignment and structure

>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A*	Back alignment and structure

>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0	Back alignment and structure

>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A	Back alignment and structure

>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli}	Back alignment and structure

>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A*	Back alignment and structure

>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A	Back alignment and structure

>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa}	Back alignment and structure

>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A*	Back alignment and structure

>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A	Back alignment and structure

>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A	Back alignment and structure

>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP}	Back alignment and structure

>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A	Back alignment and structure

>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A	Back alignment and structure

>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A	Back alignment and structure

>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana}	Back alignment and structure

>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A	Back alignment and structure

>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A	Back alignment and structure

>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens}	Back alignment and structure

>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A*	Back alignment and structure

>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum}	Back alignment and structure

>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa}	Back alignment and structure

>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19	Back alignment and structure

>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A	Back alignment and structure

>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A	Back alignment and structure

>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A*	Back alignment and structure

>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii}	Back alignment and structure

>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli}	Back alignment and structure

>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis}	Back alignment and structure

>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A	Back alignment and structure

>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0	Back alignment and structure

>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei}	Back alignment and structure

>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified}	Back alignment and structure

>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A	Back alignment and structure

>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A	Back alignment and structure

>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A*	Back alignment and structure

>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13	Back alignment and structure

>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A*	Back alignment and structure

>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A*	Back alignment and structure

>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A*	Back alignment and structure

>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A*	Back alignment and structure

>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13	Back alignment and structure

>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A	Back alignment and structure

>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1	Back alignment and structure

>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum}	Back alignment and structure

>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A	Back alignment and structure

>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus}	Back alignment and structure

>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana}	Back alignment and structure

>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8}	Back alignment and structure

>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A	Back alignment and structure

>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis}	Back alignment and structure

>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A*	Back alignment and structure

>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A	Back alignment and structure

>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A*	Back alignment and structure

>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified}	Back alignment and structure

>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens}	Back alignment and structure

>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A*	Back alignment and structure

>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A*	Back alignment and structure

>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A*	Back alignment and structure

>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A	Back alignment and structure

>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli}	Back alignment and structure

>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A*	Back alignment and structure

>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A*	Back alignment and structure

>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A*	Back alignment and structure

>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A*	Back alignment and structure

>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A	Back alignment and structure

>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A	Back alignment and structure

>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus}	Back alignment and structure

>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A*	Back alignment and structure

>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A	Back alignment and structure

>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli}	Back alignment and structure

>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A*	Back alignment and structure

>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis}	Back alignment and structure

>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A*	Back alignment and structure

>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei}	Back alignment and structure

>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A	Back alignment and structure

>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A	Back alignment and structure

>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A*	Back alignment and structure

>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A	Back alignment and structure

>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A*	Back alignment and structure

>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A*	Back alignment and structure

>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni}	Back alignment and structure

>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A*	Back alignment and structure

>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus}	Back alignment and structure

>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A*	Back alignment and structure

>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A*	Back alignment and structure

>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A	Back alignment and structure

>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A	Back alignment and structure

>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A*	Back alignment and structure

>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A*	Back alignment and structure

>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A*	Back alignment and structure

>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A	Back alignment and structure

>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A*	Back alignment and structure

>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A*	Back alignment and structure

>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A*	Back alignment and structure

>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A	Back alignment and structure

>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A*	Back alignment and structure

>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A	Back alignment and structure

>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A	Back alignment and structure

>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A*	Back alignment and structure

>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A	Back alignment and structure

>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A*	Back alignment and structure

>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens}	Back alignment and structure

>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus}	Back alignment and structure

>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3	Back alignment and structure

>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A	Back alignment and structure

>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A	Back alignment and structure

>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A*	Back alignment and structure

>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus}	Back alignment and structure

>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3	Back alignment and structure

>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6	Back alignment and structure

>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A*	Back alignment and structure

>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6	Back alignment and structure

>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni}	Back alignment and structure

>2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae}	Back alignment and structure

>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3	Back alignment and structure

>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A*	Back alignment and structure

>1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A*	Back alignment and structure

>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3	Back alignment and structure

>2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A*	Back alignment and structure

>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus}	Back alignment and structure

>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A*	Back alignment and structure

>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A*	Back alignment and structure

>3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica}	Back alignment and structure

>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A*	Back alignment and structure

>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus}	Back alignment and structure

>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A*	Back alignment and structure

>3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A	Back alignment and structure

>3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei}	Back alignment and structure

>3ogz_A UDP-sugar pyrophosphorylase; LEFT handed beta helix, rossmann fold, UDP sugar pyrophospho transferase; 2.03A {Leishmania major} PDB: 3oh3_A* 3oh1_A* 3oh0_A* 3oh2_A* 3oh4_A*	Back alignment and structure

>2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		409
d1yp2a2		307	c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr	1e-36
d1yp2a2		307	c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr	2e-26
d1yp2a1		135	b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt	9e-34
d1fxoa_		292	c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa	4e-13
d1lvwa_		295	c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri	4e-13
d1tzfa_		259	c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf	3e-12
d1tzfa_		259	c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf	2e-05
d1mc3a_		291	c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]}	3e-12
d1jyka_		229	c.68.1.13 (A:) CTP:phosphocholine cytidylytransfer	6e-08
d2icya2		378	c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2	2e-06
d2cu2a2		268	c.68.1.20 (A:1-268) Putative mannose-1-phosphate g	1e-05
d1g97a2		250	c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate	3e-05
d2oi6a2		248	c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate	6e-04

>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain
species: Potato (Solanum tuberosum) [TaxId: 4113]

 Score =  133 bits (335), Expect = 1e-36
 Identities = 109/115 (94%), Positives = 115/115 (100%)

Query: 160 KQLKAMKVDTTILGLDDERAKEMPYIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG 219
           +QL+AMKVDTTILGLDD+RAKEMP+IASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG
Sbjct: 193 EQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPG 252

Query: 220 ATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPR 274
           ATS+GMRVQAYLYDGYWEDIGTIEAFYNANLGITKKP+PDFSFYDRSAPIYTQPR
Sbjct: 253 ATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPR 307

PyMOL of d1yp2a2

>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307	Back information, alignment and structure

>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135	Back information, alignment and structure

>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292	Back information, alignment and structure

>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295	Back information, alignment and structure

>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259	Back information, alignment and structure

>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259	Back information, alignment and structure

>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291	Back information, alignment and structure

>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Length = 229	Back information, alignment and structure

>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 378	Back information, alignment and structure

>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Length = 268	Back information, alignment and structure

>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250	Back information, alignment and structure

>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 248	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		409
d1yp2a2		307	Glucose-1-phosphate adenylyltransferase small subu	100.0
d1tzfa_		259	Glucose-1-phosphate cytidylyltransferase RfbF {Sal	99.95
d1fxoa_		292	RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]}	99.92
d1mc3a_		291	RffH {Escherichia coli [TaxId: 562]}	99.92
d1yp2a1		135	Glucose-1-phosphate adenylyltransferase small subu	99.9
d2cu2a2		268	Putative mannose-1-phosphate guanylyl transferase	99.87
d1lvwa_		295	RmlA (RfbA) {Archaeon Methanobacterium thermoautot	99.87
d1jyka_		229	CTP:phosphocholine cytidylytransferase LicC {Strep	99.85
d1g97a2		250	N-acetylglucosamine 1-phosphate uridyltransferase	99.82
d2oi6a2		248	N-acetylglucosamine 1-phosphate uridyltransferase	99.8
d2jf2a1		262	UDP N-acetylglucosamine acyltransferase {Escherich	99.48
d1i52a_		225	4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me)	99.44
d1j2za_		259	UDP N-acetylglucosamine acyltransferase {Helicobac	99.39
d1qrea_		210	gamma-carbonic anhydrase {Archaeon Methanosarcina	99.36
d1w77a1		226	4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me)	99.33
d1vpaa_		221	4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me)	99.31
d2jf2a1		262	UDP N-acetylglucosamine acyltransferase {Escherich	99.29
d1vgwa_		226	4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me)	99.24
d1xhda_		172	Putative acetyltransferase/acyltransferase BC4754	99.2
d1v3wa_		173	Ferripyochelin binding protein {Archaeon Pyrococcu	99.19
d1j2za_		259	UDP N-acetylglucosamine acyltransferase {Helicobac	99.18
d1fxja1		78	N-acetylglucosamine 1-phosphate uridyltransferase	99.17
d3bswa1		193	Acetyltransferase PglD {Campylobacter jejuni [TaxI	99.17
d1g97a1		196	N-acetylglucosamine 1-phosphate uridyltransferase	99.11
d1xhda_		172	Putative acetyltransferase/acyltransferase BC4754	99.06
d1qrea_		210	gamma-carbonic anhydrase {Archaeon Methanosarcina	99.06
d1e5ka_		188	Molybdenum cofactor biosynthesis protein MobA {Esc	99.03
d3bswa1		193	Acetyltransferase PglD {Campylobacter jejuni [TaxI	98.99
d1g97a1		196	N-acetylglucosamine 1-phosphate uridyltransferase	98.98
d2dpwa1		231	Uncharacterized protein TTHA0179 {Thermus thermoph	98.91
d3tdta_		274	Tetrahydrodipicolinate-N-succinlytransferase, THDP	98.9
d2oi6a1		201	N-acetylglucosamine 1-phosphate uridyltransferase	98.88
d1krra_		200	Galactoside acetyltransferase {Escherichia coli [T	98.88
d1krra_		200	Galactoside acetyltransferase {Escherichia coli [T	98.81
d2oi6a1		201	N-acetylglucosamine 1-phosphate uridyltransferase	98.79
d1yp2a1		135	Glucose-1-phosphate adenylyltransferase small subu	98.78
d1fxja1		78	N-acetylglucosamine 1-phosphate uridyltransferase	98.75
d1h7ea_		245	CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn	98.73
d1v3wa_		173	Ferripyochelin binding protein {Archaeon Pyrococcu	98.73
d1vh1a_		246	CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn	98.73
d1ocxa_		182	Maltose O-acetyltransferase {Escherichia coli [Tax	98.7
d1vica_		255	CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn	98.7
d2f9ca1		320	Hypothetical protein YdcK {Salmonella enterica [Ta	98.61
d1w55a1		205	IspD/IspF bifunctional enzyme, CDP-me synthase dom	98.54
d1ocxa_		182	Maltose O-acetyltransferase {Escherichia coli [Tax	98.52
d3tdta_		274	Tetrahydrodipicolinate-N-succinlytransferase, THDP	98.46
d1mr7a_		203	Xenobiotic acetyltransferase {Enterococcus faecium	98.36
d1mr7a_		203	Xenobiotic acetyltransferase {Enterococcus faecium	98.2
d2f9ca1		320	Hypothetical protein YdcK {Salmonella enterica [Ta	98.15
d1qwja_		228	CMP acylneuraminate synthetase {Mouse (Mus musculu	98.11
d1ssqa_		241	Serine acetyltransferase {Haemophilus influenzae [	98.09
d1xata_		208	Xenobiotic acetyltransferase {Pseudomonas aerugino	97.98
d1ssqa_		241	Serine acetyltransferase {Haemophilus influenzae [	97.95
d1xata_		208	Xenobiotic acetyltransferase {Pseudomonas aerugino	97.95
d1eyra_		225	CMP acylneuraminate synthetase {Neisseria meningit	97.43
d2icya2		378	UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c	97.17
d1jv1a_		501	UDP-N-acetylglucosamine pyrophosphorylase {Human (	94.77

>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain
species: Potato (Solanum tuberosum) [TaxId: 4113]

Probab=100.00  E-value=1.4e-34  Score=278.50  Aligned_cols=196  Identities=89%  Similarity=1.380  Sum_probs=159.7

Q ss_pred             cccCCccccCceEEEEEcCCCCCCCCCCcCCCCCcceEeCCCcchHHHHHHhhhhCCCceEEEEcccChhhHHHHHHHHH
Q 015296           79 QTCLDPEASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAY  158 (409)
Q Consensus        79 ~~~~~~~~~~~m~aIILAaG~GtRl~Plt~~~PK~LlPI~g~~pLI~~~l~~l~~~Gi~~I~Vv~~~~~~~i~~~l~~~~  158 (409)
                      ++|.+|+++++|.|||||||.||||+|||+.+||||+||+|++|||+|+|++|.++||++|+|+++++.+++.+|+.+.|
T Consensus         1 ~~~~~~~~~~~~~AIILAaG~GtRL~plT~~~PK~llpv~g~~plI~~~l~~l~~~gi~~I~Iv~~~~~~~i~~~l~~~~   80 (307)
T d1yp2a2           1 QTCLDPDASRSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAY   80 (307)
T ss_dssp             CCCCSSCHHHHEEEEEC------CCTTTTTTSCGGGCEETTTEETTHHHHHHHHHTTCCEEEEEESCCCHHHHHHHHHHC
T ss_pred             CCccCCCcCCceEEEEECCCCcccCChhhcCCCcceEEECCCCCHHHHHHHHHHHcCCCEEEEEeccccccchhhhhccc
Confidence            47999999999999999999999999999999999999998789999999999999999999999999999999987642


Q ss_pred             H------------------------------------------------------------------HHHHHcCCCeEEE
Q 015296          159 A------------------------------------------------------------------KQLKAMKVDTTIL  172 (409)
Q Consensus       159 ~------------------------------------------------------------------e~~~~~~~d~til  172 (409)
                      .                                                                  +.|+..+.+.++.
T Consensus        81 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~g~~~ai~~~~~~i~~~~~~~~iv~~~D~~~~~d~~~~~~~~~~~~~~~~~~  160 (307)
T d1yp2a2          81 ASNMGGYKNEGFVEVLAAQQSPENPDWFQGTADAVRQYLWLFEEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVA  160 (307)
T ss_dssp             C--------CCEEEEEESCSSTTSCCCCCSHHHHHHHTHHHHTTSCCSEEEEECSCEECCCCHHHHHHHHHHTTCSEEEE
T ss_pred             ccccccccccccceeeceeeeccccccccchhHHHHHhHHhhhccccceEEEecCcceeccchhhhhhhhhhccccceEE
Confidence            1                                                                  2222223332222


Q ss_pred             ---------------EecCC----cccCC--------------------------CcEEEEEEEEEeHHHHHHHHhhcCC
Q 015296          173 ---------------GLDDE----RAKEM--------------------------PYIASMGIYVISKDVMLNLLRDKFP  207 (409)
Q Consensus       173 ---------------~~~~~----~~~ek--------------------------p~~~~~Giyif~~~vl~~ll~~~~~  207 (409)
                                     .++++    .+.|+                          +.+.++|+|+|++++|.+++....+
T Consensus       161 ~~~~~~~~~~~~gvv~~d~~~~v~~~~Ek~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~giyi~~~~~l~~~~~~~~~  240 (307)
T d1yp2a2         161 ALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFP  240 (307)
T ss_dssp             EEEECHHHHTTSEEEEECTTSBEEEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHHHHHHHTTCT
T ss_pred             EEecccccccccceEEECCCCcEEEEEECCCCcccccccccccccccccchhhcccchhhCceEEECHHHHHHHhhhccc
Confidence                           22221    11222                          2588999999999999988887777


Q ss_pred             CCCcchhchHHHHHhCCCeEEEEEecCeEEEcCCHHHHHHHHHhhccCCCCCCcccCCCCCccCCCc
Q 015296          208 GANDFGSEVIPGATSIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPIPDFSFYDRSAPIYTQPR  274 (409)
Q Consensus       208 ~~~d~~~dli~~ll~~g~~V~a~~~~gyw~DIgt~edy~~an~~ll~~~~~~~~~~~~~~~i~~~~~  274 (409)
                      +..++..|+++.++++|.++.+++++|||.||||+++|++||++++++..+.+.||+++.+|||.++
T Consensus       241 ~~~~~~~d~i~~li~~g~~v~~~~~~g~W~Digt~~~~~~a~~~ll~~~~~~~~~~~~~~~i~~~~~  307 (307)
T d1yp2a2         241 GANDFGSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPR  307 (307)
T ss_dssp             TCCCTTTTHHHHHHHTTCCEEEEECCSCCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCCC
T ss_pred             cccchHHHHHHHHHHCCCcEEEEEeCCeEEECcCHHHHHHHHHHHhcCCCchhhccCCCCCccCCCC
Confidence            7778889999999999999999999999999999999999999999999888899999999999764

PyMOL of d1yp2a2

>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]}	Back information, alignment and structure

>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}	Back information, alignment and structure

>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]}	Back information, alignment and structure

>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}	Back information, alignment and structure

>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}	Back information, alignment and structure

>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]}	Back information, alignment and structure

>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]}	Back information, alignment and structure

>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]}	Back information, alignment and structure

>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]}	Back information, alignment and structure

>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]}	Back information, alignment and structure

>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]}	Back information, alignment and structure

>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]}	Back information, alignment and structure

>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]}	Back information, alignment and structure

>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}	Back information, alignment and structure

>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}	Back information, alignment and structure

>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]}	Back information, alignment and structure

>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]}	Back information, alignment and structure