Citrus Sinensis ID: 015313

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41

MEVFKAAYKKGSMARDSVAIRADQKSYSYDQLASSALRISSLLCSNDLKTTSEKTKNENSAVLAGGCGARIGIVAKPSFEFVAGVLGTWFSGCIAVPLALSYPESELLHVMHDSDISMVLSTEDYREVLQNVASKSGAKFSLIPPVPNVSSETTVFDQSQAEKMDGQRGEDPALIVYTSGTTGKPKGVVHTHKSIDAQVQMLTEAWEYTSADQFLHCLPLHHVHGLFNALLAPLYAGATVEFMPKFSVRGIWQRWRESYPVNGNRAGEAITAFTGVPTMYTRLIQGYEAMDTELQAASASAAKQLRLMMCGSSALPLPVMQQWETITGHRLLERYGMTEFVMAISNPLRGARKAGTVGNPLPGVQVKIAEDESGSDAAGVGEICVKSPSLFKEYWKLPKESRTLSSCLY

ccHHHHHHHHcccccccEEEEEcccEEcHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHHcccEEcccccccHHHHHHHHccccccEEEEccccHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccEEEEcccccccccccHHccHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHcccccccccccccEEcccHHHHHHHHHccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHcccccECccccHHHcHHcccccccccccccccccccccEEEEECcccccccccccEEEECccccHHHHccccccccccccccc

MEVFKAAYKKGSMARDSVAIRADQKSYSYDQLASSALRISSLLCSNDLKTTSEKTKNENSAVLAGGCGARIGIVAKPSFEFVAGVLGTWFSGCIAVPLALSYPESELLHVMHDSDISMVLSTEDYREVLQNVASKSGAKFSLIPPVPNVSSETT***********GQRGEDPALIVYTSGTTGKPKGVVHTHKSIDAQVQMLTEAWEYTSADQFLHCLPLHHVHGLFNALLAPLYAGATVEFMPKFSVRGIWQRWRESYPVNGNRAGEAITAFTGVPTMYTRLIQGYEAMDTELQAASASAAKQLRLMMCGSSALPLPVMQQWETITGHRLLERYGMTEFVMAISNPLRGARKAGTVGNPLPGVQVKIAEDESGSDAAGVGEICVKSPSLFKEYWKLPKESRTLSSCLY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Malonate--CoA ligase	Malonate--CoA ligase that catalyzes the formation of malonyl-CoA directly from malonate and CoA. May be required for the detoxification of malonate.	probable	Q8H151

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G7S, chain A
Confidence level:very confident
Coverage over the Query: 1-46,64-254,265-409
View the alignment between query and template
View the model in PyMOL

Template: 3B7W, chain A
Confidence level:probable
Coverage over the Query: 47-386
View the alignment between query and template
View the model in PyMOL