Citrus Sinensis ID: 015327


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MAARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHRVTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFIGLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQDRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKADIGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGIDGLSSTEFIQVLELNFLFTLDTVIAILQTAFTSKKDFGKEERELLWAHAQRTLHGLQPPDTSMFSVRSSYGELSWMAEEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAIQQSYSV
ccccccccccccHHHHHHHHcccccHHHHHcccEEEEccccccccEEEEEEEcccccEEEEEcccHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHEEcccccccccccccccEEEEEEccccccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHcccEEEcccccHHHHHHHHHHHcccEEEEcccccccHHHHcccccccccccccHHHHHHHcHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccc
ccHHHHHcccccHHHHHHHHHHccHHHHHHccccEEEccccccccEEEEEEEcccccEEEEEcccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHccccccccccEEccccHHHHccHHHHHHHHHHccEEEEccHHHHHHHHHHHHHcccEEEEcccccccHHHHHHccEEEEEccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccHHHHHHHcHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHEEEEEEccccHHHHcccccc
maarasqvenLDVIDAAIVGMLadpkearadiqevhflpfdptgkrtaltyidsegkmhrvtkgspEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQevpegskessgspwqfigliplfdppihdsAETIRRALSLGLGVKMITGDQLAIAKETgrrlgmgtnmypssalsgqdrdesivalpvdeliekadgfagvfpeHKYEIVKHLQARNHICGmigngvndapalkkadIGIAVADATDAARSAAdivltepglNVIITAVLISRAIFQRMRNYMVRGIDGLSSTEFIQVLELNFLFTLDTVIAILQTAFTSKKDFGKEERELLWAHAQRtlhglqppdtsmfsVRSSYGELSWMAEEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAIQQSYSV
maarasqvenldviDAAIVGMLADPKEARADIQEvhflpfdptgkrTALTYIDSEGKMHRVTKGSPEQILNLlhnkskigrKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFIGLIPLFDPPIHDSAETIRRALSlglgvkmitgDQLAIAKETGRRLGMGTNMYPSSALSGQDRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKADIGIAVADATDAARSAADivltepglnvIITAVLISRAIFQRMRNYMVRGIDGLSSTEFIQVLELNFLFTLDTVIAILQTAFTSKKDFGKEERELLWAHAQRtlhglqppdtsmFSVRSSYGELSWMAEEARRRAEIARLRELHTLKGHVeslirlkgldidaiqqsysv
MAARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHRVTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFIGLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQDRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKadigiavadatdaarsaadiVLTEPGLNVIITAVLISRAIFQRMRNYMVRGIDGLSSTEFIQVLELNFLFTLDTVIAILQTAFTSKKDFGKEERELLWAHAQRTLHGLQPPDTSMFSVRSSYGELSWMaeearrraeiarlrelHTLKGHVESLIRLKGLDIDAIQQSYSV
*********NLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDS*************QILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQ************PWQFIGLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETG***********************IVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKADIGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGIDGLSSTEFIQVLELNFLFTLDTVIAILQTAFTSKKDFGKEERELLWAHAQRTLHGL*********V**SYGELSWMAEEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAI******
MAARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHRVTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPE***ESSGSPWQFIGLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSG********ALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKADIGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGIDGLSSTEFIQVLELNFLFTLDTVIAILQTAFTSKKDFGKEEREL*************PPDTSMFSVRSSYGELSWMAEEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAIQQSY**
********ENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHRVTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAY************SPWQFIGLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQDRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKADIGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGIDGLSSTEFIQVLELNFLFTLDTVIAILQTAFTSKKDFGKEERELLWAHAQRTLHGLQPPDTSMFSVRSSYGELSWMAEEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAIQQSYSV
*********NLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHRVTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFIGLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQDRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKADIGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGIDGLSSTEFIQVLELNFLFTLDTVIAILQTAFTSKKDFGKEERELLWAHAQRTLHGLQPPDTSMFSVRSSYGELSWMAEEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAIQQSYS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHRVTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFIGLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQDRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKADIGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGIDGLSSTEFIQVLELNFLFTLDTVIAILQTAFTSKKDFGKEERELLWAHAQRTLHGLQPPDTSMFSVRSSYGELSWMAEEARRRAEIARLRELHTLKGHVESLIRLKGLDIDAIQQSYSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query409 2.2.26 [Sep-21-2011]
Q9SU58 960 ATPase 4, plasma membrane yes no 0.709 0.302 0.834 1e-142
Q9LV11 956 ATPase 11, plasma membran no no 0.709 0.303 0.824 1e-141
Q08435 957 Plasma membrane ATPase 1 N/A no 0.709 0.303 0.827 1e-141
P23980 704 Plasma membrane ATPase 2 N/A no 0.652 0.379 0.824 1e-141
Q08436 956 Plasma membrane ATPase 3 N/A no 0.709 0.303 0.831 1e-141
P22180 956 Plasma membrane ATPase 1 N/A no 0.709 0.303 0.820 1e-140
Q7XPY2 951 Plasma membrane ATPase OS no no 0.760 0.327 0.709 1e-131
Q9SJB3 949 ATPase 5, plasma membrane no no 0.706 0.304 0.765 1e-130
P83970 951 Plasma membrane ATPase OS N/A no 0.645 0.277 0.768 1e-130
P20431 949 ATPase 3, plasma membrane no no 0.706 0.304 0.741 1e-128
>sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=1 SV=2 Back     alignment and function desciption
 Score =  506 bits (1304), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 242/290 (83%), Positives = 269/290 (92%)

Query: 1   MAARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHR 60
           MAARAS++EN D IDAAIVGMLADPK+ARA IQEVHFLPF+PT KRTALTYID+EG  HR
Sbjct: 369 MAARASRLENQDAIDAAIVGMLADPKDARAGIQEVHFLPFNPTDKRTALTYIDNEGNTHR 428

Query: 61  VTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFI 120
           V+KG+PEQILNL HNKS+I R+V+AVI+KFAERGLRSLAVAYQ+VPEG K+S+G PWQF+
Sbjct: 429 VSKGAPEQILNLAHNKSEIERRVHAVIDKFAERGLRSLAVAYQDVPEGRKDSAGGPWQFV 488

Query: 121 GLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQ 180
           GL+PLFDPP HDSAETIRRAL+LG+ VKMITGDQLAI KETGRRLGMGTNMYPSSAL GQ
Sbjct: 489 GLMPLFDPPRHDSAETIRRALNLGVSVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ 548

Query: 181 DRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKAD 240
           ++DESIVALPVDELIEKADGFAGVFPEHKYEIVK LQAR HICGM G+GVNDAPALKKAD
Sbjct: 549 NKDESIVALPVDELIEKADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKAD 608

Query: 241 IGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGI 290
           IGIAVADATDAARSA+DIVLTEPGL+VII+AVL SRAIFQRM+NY +  +
Sbjct: 609 IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAV 658




The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport. The resulting external acidification and/or internal alkinization may mediate growth responses.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 6
>sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 Back     alignment and function description
>sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 Back     alignment and function description
>sp|P23980|PMA2_SOLLC Plasma membrane ATPase 2 (Fragment) OS=Solanum lycopersicum GN=LHA2 PE=3 SV=1 Back     alignment and function description
>sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 Back     alignment and function description
>sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 Back     alignment and function description
>sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 Back     alignment and function description
>sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 Back     alignment and function description
>sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query409
449440750 959 PREDICTED: ATPase 4, plasma membrane-typ 0.709 0.302 0.848 1e-142
33943131 956 plasma membrane H+-ATPase [Juglans regia 0.797 0.341 0.768 1e-142
6759599 956 plasma membrane H+ ATPase [Prunus persic 0.652 0.279 0.837 1e-141
449528800 959 PREDICTED: LOW QUALITY PROTEIN: ATPase 4 0.709 0.302 0.844 1e-141
225456641 956 PREDICTED: ATPase 11, plasma membrane-ty 0.797 0.341 0.765 1e-141
224121558 966 autoinhibited H+ ATPase [Populus trichoc 0.652 0.276 0.844 1e-141
31580855 956 plasma membrane H+-ATPase [Sesbania rost 0.709 0.303 0.837 1e-141
224135653 967 autoinhibited H+ ATPase [Populus trichoc 0.709 0.299 0.841 1e-141
30692952 960 H(+)-ATPase 4 [Arabidopsis thaliana] gi| 0.709 0.302 0.834 1e-141
312282347 956 unnamed protein product [Thellungiella h 0.709 0.303 0.824 1e-140
>gi|449440750|ref|XP_004138147.1| PREDICTED: ATPase 4, plasma membrane-type-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  511 bits (1315), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 246/290 (84%), Positives = 267/290 (92%)

Query: 1   MAARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHR 60
           MAARAS+ EN D ID AIVGMLADPKEARA IQEVHFLPF+PT KRTALTYID EGKMHR
Sbjct: 368 MAARASRTENQDAIDTAIVGMLADPKEARAGIQEVHFLPFNPTDKRTALTYIDHEGKMHR 427

Query: 61  VTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFI 120
           V+KG+PEQILNL HNKS+I RKV+AVI+KFAERGLRSLAVAYQEVP+G KES+G PWQF+
Sbjct: 428 VSKGAPEQILNLAHNKSEIERKVHAVIDKFAERGLRSLAVAYQEVPDGRKESAGGPWQFV 487

Query: 121 GLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQ 180
           GL+PLFDPP HDSAETIRRAL+LG+ VKMITGDQLAI KETGRRLGMGTNMYPSSAL GQ
Sbjct: 488 GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ 547

Query: 181 DRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKAD 240
           D+DESI ALPVDELIEKADGFAGVFPEHKYEIVK LQAR HICGM G+GVNDAPALKKAD
Sbjct: 548 DKDESIAALPVDELIEKADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKAD 607

Query: 241 IGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGI 290
           IGIAVADATDAARSA+DIVLTEPGL+VII+AVL SRAIFQRM+NY +  +
Sbjct: 608 IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAV 657




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|33943131|gb|AAQ55291.1| plasma membrane H+-ATPase [Juglans regia] Back     alignment and taxonomy information
>gi|6759599|emb|CAB69824.1| plasma membrane H+ ATPase [Prunus persica] Back     alignment and taxonomy information
>gi|449528800|ref|XP_004171391.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 4, plasma membrane-type-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225456641|ref|XP_002270344.1| PREDICTED: ATPase 11, plasma membrane-type [Vitis vinifera] gi|297734039|emb|CBI15286.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224121558|ref|XP_002318614.1| autoinhibited H+ ATPase [Populus trichocarpa] gi|222859287|gb|EEE96834.1| autoinhibited H+ ATPase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|31580855|dbj|BAC77532.1| plasma membrane H+-ATPase [Sesbania rostrata] Back     alignment and taxonomy information
>gi|224135653|ref|XP_002322127.1| autoinhibited H+ ATPase [Populus trichocarpa] gi|222869123|gb|EEF06254.1| autoinhibited H+ ATPase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30692952|ref|NP_190378.2| H(+)-ATPase 4 [Arabidopsis thaliana] gi|83305346|sp|Q9SU58.2|PMA4_ARATH RecName: Full=ATPase 4, plasma membrane-type; AltName: Full=Proton pump 4 gi|26451228|dbj|BAC42716.1| putative H+-transporting ATPase [Arabidopsis thaliana] gi|332644829|gb|AEE78350.1| H(+)-ATPase 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312282347|dbj|BAJ34039.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query409
TAIR|locus:2097895 960 HA4 "H(+)-ATPase 4" [Arabidops 0.794 0.338 0.697 7.8e-144
TAIR|locus:2172244 956 HA11 "H(+)-ATPase 11" [Arabido 0.794 0.339 0.688 4.3e-143
TAIR|locus:2046623 949 HA5 "H(+)-ATPase 5" [Arabidops 0.797 0.343 0.648 4.8e-131
TAIR|locus:2025727 954 HA9 "H(+)-ATPase 9" [Arabidops 0.794 0.340 0.614 1.7e-126
TAIR|locus:2044450 949 HA1 "H(+)-ATPase 1" [Arabidops 0.794 0.342 0.638 1.5e-125
TAIR|locus:2096549 948 HA8 "H(+)-ATPase 8" [Arabidops 0.709 0.305 0.679 3.1e-125
TAIR|locus:2165600 949 HA3 "H(+)-ATPase 3" [Arabidops 0.794 0.342 0.626 5.7e-124
TAIR|locus:2053343 949 HA6 "H(+)-ATPase 6" [Arabidops 0.794 0.342 0.600 7.4e-122
TAIR|locus:2081932 961 HA7 "H(+)-ATPase 7" [Arabidops 0.789 0.336 0.615 6.1e-114
TAIR|locus:2020372 947 AHA10 "autoinhibited H(+)-ATPa 0.794 0.343 0.624 1.7e-109
TAIR|locus:2097895 HA4 "H(+)-ATPase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1147 (408.8 bits), Expect = 7.8e-144, Sum P(2) = 7.8e-144
 Identities = 233/334 (69%), Positives = 266/334 (79%)

Query:     1 MAARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHR 60
             MAARAS++EN D IDAAIVGMLADPK+ARA IQEVHFLPF+PT KRTALTYID+EG  HR
Sbjct:   369 MAARASRLENQDAIDAAIVGMLADPKDARAGIQEVHFLPFNPTDKRTALTYIDNEGNTHR 428

Query:    61 VTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFI 120
             V+KG+PEQILNL HNKS+I R+V+AVI+KFAERGLRSLAVAYQ+VPEG K+S+G PWQF+
Sbjct:   429 VSKGAPEQILNLAHNKSEIERRVHAVIDKFAERGLRSLAVAYQDVPEGRKDSAGGPWQFV 488

Query:   121 GLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQ 180
             GL+PLFDPP HDSAETIRRAL+LG+ VKMITGDQLAI KETGRRLGMGTNMYPSSAL GQ
Sbjct:   489 GLMPLFDPPRHDSAETIRRALNLGVSVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ 548

Query:   181 DRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKXX 240
             ++DESIVALPVDELIEKADGFAGVFPEHKYEIVK LQAR HICGM G+GVNDAPALKK  
Sbjct:   549 NKDESIVALPVDELIEKADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKAD 608

Query:   241 XXXXXXXXXXXXXXXXXXVLTEPGLNVIITAVLISRAIFQRMRNYMVRGIDGLSSTEFIQ 300
                               VLTEPGL+VII+AVL SRAIFQRM+NY +  +  ++    + 
Sbjct:   609 IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVS-ITIRIVLG 667

Query:   301 VLELNFLFTLD------TVIAILQ--TAFTSKKD 326
              + L  ++  D       +IAIL   T  T  KD
Sbjct:   668 FMLLALIWQFDFPPFMVLIIAILNDGTIMTISKD 701


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006200 "ATP catabolic process" evidence=IEA
GO:0006754 "ATP biosynthetic process" evidence=IEA
GO:0006812 "cation transport" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0015662 "ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA;ISS
GO:0046872 "metal ion binding" evidence=IEA
GO:0008553 "hydrogen-exporting ATPase activity, phosphorylative mechanism" evidence=ISS
GO:0009651 "response to salt stress" evidence=IMP
GO:0007059 "chromosome segregation" evidence=RCA
GO:0007062 "sister chromatid cohesion" evidence=RCA
GO:0007129 "synapsis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0010089 "xylem development" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0042138 "meiotic DNA double-strand break formation" evidence=RCA
GO:0044036 "cell wall macromolecule metabolic process" evidence=RCA
GO:0045132 "meiotic chromosome segregation" evidence=RCA
TAIR|locus:2172244 HA11 "H(+)-ATPase 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046623 HA5 "H(+)-ATPase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025727 HA9 "H(+)-ATPase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044450 HA1 "H(+)-ATPase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096549 HA8 "H(+)-ATPase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2165600 HA3 "H(+)-ATPase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053343 HA6 "H(+)-ATPase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081932 HA7 "H(+)-ATPase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020372 AHA10 "autoinhibited H(+)-ATPase isoform 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SU58PMA4_ARATH3, ., 6, ., 3, ., 60.83440.70900.3020yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.30.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query409
TIGR01647754 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-e 1e-144
COG0474917 COG0474, MgtA, Cation transport ATPase [Inorganic 2e-69
TIGR01494543 TIGR01494, ATPase_P-type, ATPase, P-type (transpor 2e-52
TIGR01522884 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium- 3e-37
TIGR01116917 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic retic 2e-35
PRK10517902 PRK10517, PRK10517, magnesium-transporting ATPase 2e-32
COG2217713 COG2217, ZntA, Cation transport ATPase [Inorganic 2e-30
TIGR01524867 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating 2e-30
TIGR01511572 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans 2e-27
TIGR01525556 TIGR01525, ATPase-IB_hvy, heavy metal translocatin 7e-27
TIGR01523 1053 TIGR01523, ATPase-IID_K-Na, potassium and/or sodiu 2e-26
PRK15122903 PRK15122, PRK15122, magnesium-transporting ATPase; 5e-25
TIGR01517944 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- 4e-24
TIGR01512536 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb 2e-21
TIGR01106 997 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux 2e-19
PRK10671834 PRK10671, copA, copper exporting ATPase; Provision 8e-19
TIGR016571054 TIGR01657, P-ATPase-V, P-type ATPase of unknown pu 3e-18
COG2216681 COG2216, KdpB, High-affinity K+ transport system, 3e-18
PRK01122679 PRK01122, PRK01122, potassium-transporting ATPase 3e-17
PRK11033741 PRK11033, zntA, zinc/cadmium/mercury/lead-transpor 3e-13
TIGR01497675 TIGR01497, kdpB, K+-transporting ATPase, B subunit 8e-11
PRK14010673 PRK14010, PRK14010, potassium-transporting ATPase 8e-10
COG4087152 COG4087, COG4087, Soluble P-type ATPase [General f 4e-09
pfam00702187 pfam00702, Hydrolase, haloacid dehalogenase-like h 5e-07
PRK01158230 PRK01158, PRK01158, phosphoglycolate phosphatase; 2e-04
TIGR00338219 TIGR00338, serB, phosphoserine phosphatase SerB 0.001
TIGR00099256 TIGR00099, Cof-subfamily, Cof subfamily of IIB sub 0.001
pfam08282254 pfam08282, Hydrolase_3, haloacid dehalogenase-like 0.002
TIGR01487215 TIGR01487, Pglycolate_arch, phosphoglycolate phosp 0.004
>gnl|CDD|233506 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
 Score =  428 bits (1103), Expect = e-144
 Identities = 172/322 (53%), Positives = 215/322 (66%), Gaps = 15/322 (4%)

Query: 2   AARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSE-GKMHR 60
           AA AS+ E+ D ID A++G   D KEAR   + + F+PFDP  KRT  T  D E GK  +
Sbjct: 323 AALASREEDQDAIDTAVLGSAKDLKEARDGYKVLEFVPFDPVDKRTEATVEDPETGKRFK 382

Query: 61  VTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFI 120
           VTKG+P+ IL+L  NK +I  KV   +++ A RG R+L VA               W F+
Sbjct: 383 VTKGAPQVILDLCDNKKEIEEKVEEKVDELASRGYRALGVART--------DEEGRWHFL 434

Query: 121 GLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQ 180
           GL+PLFDPP HD+ ETI RA  LG+ VKM+TGD LAIAKET RRLG+GTN+Y +  L   
Sbjct: 435 GLLPLFDPPRHDTKETIERARHLGVEVKMVTGDHLAIAKETARRLGLGTNIYTADVLLKG 494

Query: 181 DRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKAD 240
           D  + +    + E++E ADGFA VFPEHKYEIV+ LQ R H+ GM G+GVNDAPALKKAD
Sbjct: 495 DNRDDL-PSGLGEMVEDADGFAEVFPEHKYEIVEILQKRGHLVGMTGDGVNDAPALKKAD 553

Query: 241 IGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGIDG---LSSTE 297
           +GIAVA ATDAARSAADIVLTEPGL+VI+ A+L SR IFQRM++Y++  I     +    
Sbjct: 554 VGIAVAGATDAARSAADIVLTEPGLSVIVDAILESRKIFQRMKSYVIYRIAETIRIVFFF 613

Query: 298 FIQVLELNFLFTLDTV--IAIL 317
            + +L LNF F    V  IAIL
Sbjct: 614 GLLILILNFYFPPIMVVIIAIL 635


This model describes the plasma membrane proton efflux P-type ATPase found in plants, fungi, protozoa, slime molds and archaea. The best studied representative is from yeast. Length = 754

>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|233277 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|236705 PRK10517, PRK10517, magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130587 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|130586 TIGR01523, ATPase-IID_K-Na, potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>gnl|CDD|237914 PRK15122, PRK15122, magnesium-transporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|211664 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|130176 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>gnl|CDD|225126 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234905 PRK01122, PRK01122, potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|130561 TIGR01497, kdpB, K+-transporting ATPase, B subunit Back     alignment and domain information
>gnl|CDD|184448 PRK14010, PRK14010, potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|226572 COG4087, COG4087, Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|234910 PRK01158, PRK01158, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|232927 TIGR00338, serB, phosphoserine phosphatase SerB Back     alignment and domain information
>gnl|CDD|232824 TIGR00099, Cof-subfamily, Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>gnl|CDD|219777 pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|213628 TIGR01487, Pglycolate_arch, phosphoglycolate phosphatase, TA0175-type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 409
KOG0205942 consensus Plasma membrane H+-transporting ATPase [ 100.0
COG0474917 MgtA Cation transport ATPase [Inorganic ion transp 100.0
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 100.0
KOG0204 1034 consensus Calcium transporting ATPase [Inorganic i 100.0
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 100.0
PRK10517902 magnesium-transporting ATPase MgtA; Provisional 100.0
PRK15122903 magnesium-transporting ATPase; Provisional 100.0
TIGR01517941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 100.0
TIGR01524867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 100.0
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 100.0
TIGR01647755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 100.0
TIGR01116917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 100.0
TIGR016571054 P-ATPase-V P-type ATPase of unknown pump specifici 100.0
TIGR016521057 ATPase-Plipid phospholipid-translocating P-type AT 100.0
PLN03190 1178 aminophospholipid translocase; Provisional 100.0
TIGR01522884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 100.0
KOG0206 1151 consensus P-type ATPase [General function predicti 100.0
KOG0203 1019 consensus Na+/K+ ATPase, alpha subunit [Inorganic 100.0
KOG02101051 consensus P-type ATPase [Inorganic ion transport a 100.0
PRK14010673 potassium-transporting ATPase subunit B; Provision 100.0
KOG0208 1140 consensus Cation transport ATPase [Inorganic ion t 100.0
PRK01122679 potassium-transporting ATPase subunit B; Provision 100.0
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 100.0
KOG0209 1160 consensus P-type ATPase [Inorganic ion transport a 100.0
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 100.0
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 100.0
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 100.0
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 99.98
COG2216681 KdpB High-affinity K+ transport system, ATPase cha 99.97
PRK10671834 copA copper exporting ATPase; Provisional 99.96
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 99.96
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 99.95
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 99.95
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 99.76
COG4087152 Soluble P-type ATPase [General function prediction 99.65
PF1324691 Hydrolase_like2: Putative hydrolase of sodium-pota 99.35
PRK01158230 phosphoglycolate phosphatase; Provisional 99.23
PRK10513270 sugar phosphate phosphatase; Provisional 99.21
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 99.21
PRK11133322 serB phosphoserine phosphatase; Provisional 99.2
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 99.17
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 99.16
PRK10976266 putative hydrolase; Provisional 99.15
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.14
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 99.12
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 99.08
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 99.06
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.05
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 99.04
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.03
PLN02887580 hydrolase family protein 99.0
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 98.9
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 98.9
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 98.89
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.79
PRK13582205 thrH phosphoserine phosphatase; Provisional 98.78
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.78
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 98.73
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 98.7
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.69
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 98.61
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 98.5
PLN02954224 phosphoserine phosphatase 98.45
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 98.44
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 98.44
PRK13222226 phosphoglycolate phosphatase; Provisional 98.39
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 98.36
COG0546220 Gph Predicted phosphatases [General function predi 98.33
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 98.33
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 98.31
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 98.27
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 98.23
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.22
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 98.18
PLN02382413 probable sucrose-phosphatase 98.12
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 98.08
PRK13288214 pyrophosphatase PpaX; Provisional 98.05
PRK13223272 phosphoglycolate phosphatase; Provisional 98.04
KOG4383 1354 consensus Uncharacterized conserved protein [Funct 98.02
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 98.01
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 97.99
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 97.98
PRK13226229 phosphoglycolate phosphatase; Provisional 97.98
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 97.9
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.87
PRK08238 479 hypothetical protein; Validated 97.87
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 97.86
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 97.84
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 97.79
PRK13225273 phosphoglycolate phosphatase; Provisional 97.72
PLN02770248 haloacid dehalogenase-like hydrolase family protei 97.69
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 97.65
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 97.65
PRK11590211 hypothetical protein; Provisional 97.6
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 97.53
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 97.51
PRK11587218 putative phosphatase; Provisional 97.49
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 97.49
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 97.46
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 97.43
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 97.41
PLN02779286 haloacid dehalogenase-like hydrolase family protei 97.33
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 97.32
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 97.29
PHA02530300 pseT polynucleotide kinase; Provisional 97.28
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 97.27
PLN02575381 haloacid dehalogenase-like hydrolase 97.27
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 97.2
PRK14988224 GMP/IMP nucleotidase; Provisional 97.18
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 97.16
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 97.11
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.09
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 97.04
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 97.02
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 96.98
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 96.97
COG4030315 Uncharacterized protein conserved in archaea [Func 96.96
PRK06769173 hypothetical protein; Validated 96.96
PTZ00174247 phosphomannomutase; Provisional 96.91
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 96.89
PLN02940382 riboflavin kinase 96.89
PRK09449224 dUMP phosphatase; Provisional 96.87
COG4359220 Uncharacterized conserved protein [Function unknow 96.72
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 96.65
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 96.56
PLN02811220 hydrolase 96.53
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 96.53
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 96.52
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 96.49
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 96.43
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 96.36
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 96.31
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 96.12
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 95.98
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 95.9
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 95.86
PRK10563221 6-phosphogluconate phosphatase; Provisional 95.86
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 95.71
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 95.64
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 95.6
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 95.57
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 95.54
PRK05446354 imidazole glycerol-phosphate dehydratase/histidino 95.49
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 95.39
TIGR01675229 plant-AP plant acid phosphatase. This model explic 95.23
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 95.19
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 95.15
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 95.11
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 94.95
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 94.42
PLN02580384 trehalose-phosphatase 94.25
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 93.89
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 93.84
PLN03017366 trehalose-phosphatase 93.82
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 93.65
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 93.44
PLN02645311 phosphoglycolate phosphatase 92.65
PHA02597197 30.2 hypothetical protein; Provisional 91.46
COG0637221 Predicted phosphatase/phosphohexomutase [General f 91.36
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 91.04
PLN02423245 phosphomannomutase 90.87
PRK10748238 flavin mononucleotide phosphatase; Provisional 90.27
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 90.06
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 89.43
PLN02177 497 glycerol-3-phosphate acyltransferase 87.85
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 87.33
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 87.29
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 86.8
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 86.17
PRK10444248 UMP phosphatase; Provisional 85.97
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 85.73
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 84.71
TIGR01684301 viral_ppase viral phosphatase. These proteins also 83.52
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 83.39
COG0241181 HisB Histidinol phosphatase and related phosphatas 83.18
PTZ00174247 phosphomannomutase; Provisional 80.37
PHA03398303 viral phosphatase superfamily protein; Provisional 80.35
>KOG0205 consensus Plasma membrane H+-transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=6.2e-85  Score=651.21  Aligned_cols=399  Identities=74%  Similarity=1.087  Sum_probs=374.7

Q ss_pred             CcccccCCcCCChhHHHHHhhccCchhhhcCceEEEEecCCCCCceEEEEEEeCCCeEEEEEcCCHHHHHHhhccCchhH
Q 015327            1 MAARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHRVTKGSPEQILNLLHNKSKIG   80 (409)
Q Consensus         1 ~a~~a~~~~~~~~~d~ai~~~~~~~~~~r~~~~~l~~~pF~s~~kr~sv~v~~~~g~~~~~~KGa~e~il~~c~~~~~~~   80 (409)
                      +|||||+.||+|+||+|++++|.||+++|.+|+++|++||||.+||++.+|.+++|+++..+||||++|+++|+.+.+++
T Consensus       365 ~A~rAsr~en~DAID~A~v~~L~dPKeara~ikevhF~PFnPV~Krta~ty~d~dG~~~r~sKGAPeqil~l~~~~~~i~  444 (942)
T KOG0205|consen  365 TAARASRKENQDAIDAAIVGMLADPKEARAGIKEVHFLPFNPVDKRTALTYIDPDGNWHRVSKGAPEQILKLCNEDHDIP  444 (942)
T ss_pred             HHHHHhhhcChhhHHHHHHHhhcCHHHHhhCceEEeeccCCccccceEEEEECCCCCEEEecCCChHHHHHHhhccCcch
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHccCcceeeeeeccCCCCcCCCCCCceEEEEEeccCCCCcchHHHHHHHHhCCCcEEEeCCCcHHHHHH
Q 015327           81 RKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFIGLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKE  160 (409)
Q Consensus        81 ~~~~~~i~~~a~~GlR~l~~a~~~~~~~~~~~~e~~l~~lG~i~l~d~lr~~~~~~I~~l~~aGi~v~mlTGD~~~ta~~  160 (409)
                      +.+++.+++|+++|+|.|++|++.++++..+..+.+|+|+|++.+.||||+++.++|.+....|+.|.|+|||....+++
T Consensus       445 ~~vh~~id~~AeRGlRSLgVArq~v~e~~~~~~g~pw~~~gllp~fdpprhdsa~tirral~lGv~VkmitgdqlaI~ke  524 (942)
T KOG0205|consen  445 ERVHSIIDKFAERGLRSLAVARQEVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKE  524 (942)
T ss_pred             HHHHHHHHHHHHhcchhhhhhhhccccccccCCCCCcccccccccCCCCccchHHHHHHHHhccceeeeecchHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCCCCCCCCccccCcchhhhhhcCChhHHhhhccceeecCHhhHHHHHHHHHhCCCEEEEEcCCcCCHHHHhhCC
Q 015327          161 TGRRLGMGTNMYPSSALSGQDRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKAD  240 (409)
Q Consensus       161 ia~~lgi~~~~~~~~~l~g~~~~~~~~~~~~~~~~~~~~v~ar~~P~~K~~iV~~lq~~g~~v~~iGDG~ND~~aLk~Ad  240 (409)
                      +++++|+.+|+||+..+.|.+.++.+...+.++++++++.|+.+.|+||+++|+.||+++|+|+|+|||+||+|+||.||
T Consensus       525 Tgrrlgmgtnmypss~llG~~~~~~~~~~~v~elie~adgfAgVfpehKy~iV~~Lq~r~hi~gmtgdgvndapaLKkAd  604 (942)
T KOG0205|consen  525 TGRRLGMGTNMYPSSALLGLGKDGSMPGSPVDELIEKADGFAGVFPEHKYEIVKILQERKHIVGMTGDGVNDAPALKKAD  604 (942)
T ss_pred             hhhhhccccCcCCchhhccCCCCCCCCCCcHHHHhhhccCccccCHHHHHHHHHHHhhcCceecccCCCcccchhhcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEEeccchHHHhhccCEEecCCChhhHHHHHHHHHHHHHHHHHHHHHHH-hh---------------------------
Q 015327          241 IGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGI-DG---------------------------  292 (409)
Q Consensus       241 vGIa~~~~~~~a~~aaDivl~~~~l~~i~~~i~~gR~~~~~i~~~~~~~~-~~---------------------------  292 (409)
                      +||++.+++++|+.+||+|+++++++.|..+++.+|.+|+||++|.+|++ .+                           
T Consensus       605 igiava~atdaar~asdiVltepglSviI~avltSraIfqrmknytiyavsitiriv~gfml~alIw~~df~pfmvliia  684 (942)
T KOG0205|consen  605 IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWEFDFSPFMVLIIA  684 (942)
T ss_pred             cceeeccchhhhcccccEEEcCCCchhhHHHHHHHHHHHHHHhhheeeeehhHHHHHHHHHHHHHHHHhcCCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999985 11                           


Q ss_pred             ------------------------------------------------------------------------hHHHHHHH
Q 015327          293 ------------------------------------------------------------------------LSSTEFIQ  300 (409)
Q Consensus       293 ------------------------------------------------------------------------i~~~~~~~  300 (409)
                                                                                              +++.+|++
T Consensus       685 ilnd~t~mtis~d~v~psp~pdswkl~~ifatgvVlgtyma~~tvif~w~~~~t~ff~~~f~v~~~~~~~~~~~~a~ylq  764 (942)
T KOG0205|consen  685 ILNDGTIMTISKDRVKPSPTPDSWKLKEIFATGVVLGTYMAIMTVIFFWAAYTTDFFPRTFGVRSLFGNEHELMSALYLQ  764 (942)
T ss_pred             HhcCCceEEEEcccCCCCCCCcccchhhhheeeeEehhHHHHHHHHHhhhhccccccccccceeeccCCHHHHHHhhhhh
Confidence                                                                                    11122222


Q ss_pred             Hhh----------------------------------------------------------------hhhhccHHHHHHH
Q 015327          301 VLE----------------------------------------------------------------LNFLFTLDTVIAI  316 (409)
Q Consensus       301 ~~~----------------------------------------------------------------~~~~~pl~~~~~l  316 (409)
                      +++                                                                +..++|++.+.+.
T Consensus       765 vsi~sqaliFvtrsr~w~~~erpg~~L~~af~~aqliatliavya~w~~a~i~~igw~w~gviw~ysi~~y~~ld~~kf~  844 (942)
T KOG0205|consen  765 VSIISQALIFVTRSRSWSFVERPGWLLLIAFFAAQLIATLIAVYANWSFARITGIGWGWAGVIWLYSIVFYIPLDILKFI  844 (942)
T ss_pred             heehhceeeEEEeccCCccccCcHHHHHHHHHHHHHHHHHHHHHheecccceecceeeeeeeEEEEEEEEEEechhhhee
Confidence            222                                                                3456788777774


Q ss_pred             ---------------HHHhccccccchhhhHhhhHHHhhhhhccCCCCCCccccccccccccchhHHHHHhhhhHHhhhh
Q 015327          317 ---------------LQTAFTSKKDFGKEERELLWAHAQRTLHGLQPPDTSMFSVRSSYGELSWMAEEARRRAEIARLRE  381 (409)
Q Consensus       317 ---------------~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~r~~~~~l~~  381 (409)
                                     ....|++..+||.++++++|...||++|++|++++         +|+|++++|+|||||+|||||
T Consensus       845 ~~y~lsg~a~~~~~~~k~~~~~kk~~~~~~~~a~~~~~qrt~~~lq~~~~---------~~~~~~a~~~~~~ae~~r~~e  915 (942)
T KOG0205|consen  845 IRYALSGKAWDRLIENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEG---------RELSEIAEEAKRRAEIARLRE  915 (942)
T ss_pred             hhhhhhhhHHHHHhcCcchhhhccccchhhhhhHHHHhhhhhcccCCCcc---------chhhHHHHHHhhhhhhhhccc
Confidence                           34468888999999999999999999999999951         699999999999999999999


Q ss_pred             hhcccchhhhhhhhcCCChhhhhccccC
Q 015327          382 LHTLKGHVESLIRLKGLDIDAIQQSYSV  409 (409)
Q Consensus       382 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~  409 (409)
                      +||||||||||+||||+|+++| |||||
T Consensus       916 ~~~l~g~vesv~klk~~d~~~~-~~~t~  942 (942)
T KOG0205|consen  916 LHTLKGHVESVVKLKGLDIETI-QHYTV  942 (942)
T ss_pred             hhhhhhhhHhhhhhcccchhhh-hhccC
Confidence            9999999999999999999999 99997



>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>KOG0206 consensus P-type ATPase [General function prediction only] Back     alignment and domain information
>KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>KOG0208 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>PF13246 Hydrolase_like2: Putative hydrolase of sodium-potassium ATPase alpha subunit Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>KOG4383 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query409
3b8c_A 885 Crystal Structure Of A Plasma Membrane Proton Pump 1e-114
1mhs_A 920 Model Of Neurospora Crassa Proton Atpase Length = 9 1e-44
2dqs_A 995 Crystal Structure Of The Calcium Pump With Amppcp I 3e-19
1kju_A 994 Ca2+-Atpase In The E2 State Length = 994 3e-19
3ba6_A 994 Structure Of The Ca2e1p Phosphoenzyme Intermediate 3e-19
3tlm_A 992 Crystal Structure Of Endoplasmic Reticulum Ca2+-Atp 4e-19
3b8e_A 998 Crystal Structure Of The Sodium-Potassium Pump Leng 2e-09
3n23_A 992 Crystal Structure Of The High Affinity Complex Betw 3e-09
2zxe_A 1028 Crystal Structure Of The Sodium - Potassium Pump In 5e-09
3sky_A274 2.1a Crystal Structure Of The Phosphate Bound Atp B 8e-07
3skx_A280 Crystal Structure Of The Atp Binding Domain Of Arch 9e-07
2o98_P52 Structure Of The 14-3-3 H+-Atpase Plant Complex Len 1e-06
3ixz_A 1034 Pig Gastric H+K+-Atpase Complexed With Aluminium Fl 1e-06
3m50_P31 Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY E 2e-05
3a1e_A287 Crystal Structure Of The P- And N-Domains Of His462 3e-04
3a1c_A287 Crystal Structure Of The P- And N-Domains Of Copa, 3e-04
3rfu_A736 Crystal Structure Of A Copper-Transporting Pib-Type 8e-04
3j09_A723 High Resolution Helical Reconstruction Of The Bacte 9e-04
>pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump Length = 885 Back     alignment and structure

Iteration: 1

Score = 409 bits (1051), Expect = e-114, Method: Compositional matrix adjust. Identities = 209/333 (62%), Positives = 245/333 (73%), Gaps = 7/333 (2%) Query: 1 MAARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHR 60 AA AS+VEN D IDAA+VGMLADPKEARA I+EVHFLPF+P KRTALTYID G HR Sbjct: 361 FAAMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHR 420 Query: 61 VTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFI 120 V+KG+PEQIL L + + +KV ++I+K+AERGLRSLAVA Q VPE +KES G+PW+F+ Sbjct: 421 VSKGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV 480 Query: 121 GLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQ 180 GL+PLFDPP HDSAETIRRAL+LG+ VKMITGDQLAI KETGRRLGMGTNMYPSSAL G Sbjct: 481 GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGT 540 Query: 181 DRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKXX 240 +D ++ ++PV+ELIEKADGFAGVFPEHKYEIVK LQ R HI GM G+GVNDAPALKK Sbjct: 541 HKDANLASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD 600 Query: 241 XXXXXXXXXXXXXXXXXXVLTEPGLNVIITAVLISRAIFQRMRNYMVRGIDGLSSTEF-- 298 VLTEPGL+VII+AVL SRAIFQRM+NY + + F Sbjct: 601 IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF 660 Query: 299 ---IQVLELNFLFTLDTVIAILQ--TAFTSKKD 326 + E +F + +IAIL T T KD Sbjct: 661 MLIALIWEFDFSAFMVLIIAILNDGTIMTISKD 693
>pdb|1MHS|A Chain A, Model Of Neurospora Crassa Proton Atpase Length = 920 Back     alignment and structure
>pdb|2DQS|A Chain A, Crystal Structure Of The Calcium Pump With Amppcp In The Absence Of Calcium Length = 995 Back     alignment and structure
>pdb|1KJU|A Chain A, Ca2+-Atpase In The E2 State Length = 994 Back     alignment and structure
>pdb|3BA6|A Chain A, Structure Of The Ca2e1p Phosphoenzyme Intermediate Of The Serca Ca2+-Atpase Length = 994 Back     alignment and structure
>pdb|3TLM|A Chain A, Crystal Structure Of Endoplasmic Reticulum Ca2+-Atpase (Serca) From Bovine Muscle Length = 992 Back     alignment and structure
>pdb|3B8E|A Chain A, Crystal Structure Of The Sodium-Potassium Pump Length = 998 Back     alignment and structure
>pdb|3N23|A Chain A, Crystal Structure Of The High Affinity Complex Between Ouabain And The E2p Form Of The Sodium-Potassium Pump Length = 992 Back     alignment and structure
>pdb|2ZXE|A Chain A, Crystal Structure Of The Sodium - Potassium Pump In The E2.2k+.Pi State Length = 1028 Back     alignment and structure
>pdb|3SKY|A Chain A, 2.1a Crystal Structure Of The Phosphate Bound Atp Binding Domain Of Archaeoglobus Fulgidus Copb Length = 274 Back     alignment and structure
>pdb|3SKX|A Chain A, Crystal Structure Of The Atp Binding Domain Of Archaeoglobus Fulgidus Copb Length = 280 Back     alignment and structure
>pdb|2O98|P Chain P, Structure Of The 14-3-3 H+-Atpase Plant Complex Length = 52 Back     alignment and structure
>pdb|3IXZ|A Chain A, Pig Gastric H+K+-Atpase Complexed With Aluminium Fluoride Length = 1034 Back     alignment and structure
>pdb|3M50|P Chain P, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY EPIBESTAT Length = 31 Back     alignment and structure
>pdb|3A1E|A Chain A, Crystal Structure Of The P- And N-Domains Of His462gln Mutant Copa, A Copper-Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 Back     alignment and structure
>pdb|3A1C|A Chain A, Crystal Structure Of The P- And N-Domains Of Copa, A Copper- Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 Back     alignment and structure
>pdb|3RFU|A Chain A, Crystal Structure Of A Copper-Transporting Pib-Type Atpase Length = 736 Back     alignment and structure
>pdb|3J09|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 723 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query409
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 1e-137
3b8c_A885 ATPase 2, plasma membrane-type; P-type ATPase, pro 3e-04
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 1e-125
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 1e-45
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 3e-45
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 5e-45
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 3e-30
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 1e-28
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 5e-28
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 1e-27
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 5e-27
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 1e-26
2o98_P52 H-ATPase PMA2, plasma membrane H+ ATPase; 14-3-3, 7e-22
3gwi_A170 Magnesium-transporting ATPase, P-type 1; P-type AT 2e-12
3m50_P31 N.plumbaginifolia H+-translocating ATPase mRNA; al 2e-11
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 2e-07
3mmz_A176 Putative HAD family hydrolase; structural genomics 5e-07
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 7e-07
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 8e-07
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 8e-07
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 2e-06
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 2e-06
3mn1_A189 Probable YRBI family phosphatase; structural genom 2e-06
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 2e-06
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 3e-06
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 1e-04
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 1e-04
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 1e-04
1l6r_A227 Hypothetical protein TA0175; structural genomics, 2e-04
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 2e-04
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 6e-04
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 Back     alignment and structure
 Score =  414 bits (1066), Expect = e-137
 Identities = 216/285 (75%), Positives = 247/285 (86%)

Query: 1   MAARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHR 60
            AA AS+VEN D IDAA+VGMLADPKEARA I+EVHFLPF+P  KRTALTYID  G  HR
Sbjct: 361 FAAMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHR 420

Query: 61  VTKGSPEQILNLLHNKSKIGRKVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFI 120
           V+KG+PEQIL L    + + +KV ++I+K+AERGLRSLAVA Q VPE +KES G+PW+F+
Sbjct: 421 VSKGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV 480

Query: 121 GLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYPSSALSGQ 180
           GL+PLFDPP HDSAETIRRAL+LG+ VKMITGDQLAI KETGRRLGMGTNMYPSSAL G 
Sbjct: 481 GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGT 540

Query: 181 DRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKAD 240
            +D ++ ++PV+ELIEKADGFAGVFPEHKYEIVK LQ R HI GM G+GVNDAPALKKAD
Sbjct: 541 HKDANLASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD 600

Query: 241 IGIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNY 285
           IGIAVADATDAAR A+DIVLTEPGL+VII+AVL SRAIFQRM+NY
Sbjct: 601 IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNY 645


>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Length = 995 Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Length = 263 Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Length = 280 Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Length = 287 Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Length = 736 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 645 Back     alignment and structure
>2o98_P H-ATPase PMA2, plasma membrane H+ ATPase; 14-3-3, electrochemical proton G cell turgor, regulation, protein binding; HET: FSC; 2.70A {Nicotiana plumbaginifolia} Length = 52 Back     alignment and structure
>3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} Length = 170 Back     alignment and structure
>3m50_P N.plumbaginifolia H+-translocating ATPase mRNA; all helical, protein-protein complex, protein binding; HET: EBT; 2.60A {Nicotiana plumbaginifolia} PDB: 3m51_P* Length = 31 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Length = 168 Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Length = 176 Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Length = 164 Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Length = 162 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Length = 188 Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Length = 180 Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} Length = 191 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Length = 189 Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Length = 211 Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Length = 195 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} Length = 217 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Length = 211 Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Length = 335 Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Length = 227 Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Length = 317 Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Length = 231 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query409
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 100.0
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 100.0
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 100.0
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 100.0
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 100.0
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 100.0
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 100.0
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 100.0
3gwi_A170 Magnesium-transporting ATPase, P-type 1; P-type AT 99.89
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 99.66
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 99.78
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.78
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 99.74
2o98_P52 H-ATPase PMA2, plasma membrane H+ ATPase; 14-3-3, 99.6
3m50_P31 N.plumbaginifolia H+-translocating ATPase mRNA; al 99.55
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.5
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.42
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.39
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.36
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.33
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.33
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.31
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.27
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.27
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.17
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.16
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.14
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.13
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.12
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.07
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.06
1y8a_A332 Hypothetical protein AF1437; structural genomics, 99.04
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 99.02
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.01
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.0
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.97
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 98.97
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.95
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 98.95
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 98.95
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 98.93
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 98.92
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 98.91
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.83
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 98.83
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 98.82
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 98.81
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 98.8
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.69
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 98.67
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 98.66
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 98.65
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.64
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 98.64
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 98.63
1te2_A226 Putative phosphatase; structural genomics, phospha 98.62
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 98.59
3fvv_A232 Uncharacterized protein; unknown function, structu 98.58
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 98.54
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 98.54
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 98.54
3sd7_A240 Putative phosphatase; structural genomics, haloaci 98.49
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 98.49
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 98.49
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 98.48
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 98.48
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 98.47
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 98.47
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 98.46
2hsz_A243 Novel predicted phosphatase; structural genomics, 98.46
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 98.43
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 98.42
4gxt_A385 A conserved functionally unknown protein; structur 98.41
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 98.41
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.41
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 98.4
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 98.4
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 98.39
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.38
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 98.35
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.35
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 98.35
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 98.34
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 98.33
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 98.33
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 98.28
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 98.28
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 98.28
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 98.25
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 98.24
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 98.23
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 98.22
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 98.21
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 98.21
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.2
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 98.19
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 98.19
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 98.18
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 98.17
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 98.17
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.16
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 98.16
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 98.12
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 98.08
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 98.05
3ib6_A189 Uncharacterized protein; structural genomics, unkn 98.05
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 98.03
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 98.03
1svj_A156 Potassium-transporting ATPase B chain; alpha-beta 98.02
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.01
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 97.97
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 97.86
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 97.83
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 97.81
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 97.76
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 97.71
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 97.68
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 97.67
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 97.63
2o2x_A218 Hypothetical protein; structural genomics, joint c 97.61
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 97.56
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 97.53
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 97.51
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.51
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 97.48
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 97.45
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 97.4
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 97.28
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 97.14
2zg6_A220 Putative uncharacterized protein ST2620, probable 97.05
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 97.04
2p11_A231 Hypothetical protein; putative haloacid dehalogena 97.03
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 96.94
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 96.84
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.71
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 96.69
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 96.68
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 96.54
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 96.46
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 96.41
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 96.33
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 96.13
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 96.08
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 96.02
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 95.92
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 95.65
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 95.06
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 94.25
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 93.46
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 92.8
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 92.2
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 91.84
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 91.05
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 88.79
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 88.4
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 88.37
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 87.72
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 87.18
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 87.18
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 85.16
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 84.24
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 82.99
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 82.92
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 80.02
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=1.4e-57  Score=496.63  Aligned_cols=329  Identities=66%  Similarity=1.011  Sum_probs=284.0

Q ss_pred             cccccCCcCCChhHHHHHhhccCchhhhcCceEEEEecCCCCCceEEEEEEeCCCeEEEEEcCCHHHHHHhhccCchhHH
Q 015327            2 AARASQVENLDVIDAAIVGMLADPKEARADIQEVHFLPFDPTGKRTALTYIDSEGKMHRVTKGSPEQILNLLHNKSKIGR   81 (409)
Q Consensus         2 a~~a~~~~~~~~~d~ai~~~~~~~~~~r~~~~~l~~~pF~s~~kr~sv~v~~~~g~~~~~~KGa~e~il~~c~~~~~~~~   81 (409)
                      |+.+++.+++||+|.|++....++...+.+++.++.+||+|.+|||++++++.+|++++|+|||||.|+++|..+++.++
T Consensus       362 aa~~~~~~~~~p~~~Al~~~~~~~~~~~~~~~~~~~~pF~s~~k~~sv~~~~~~g~~~~~~KGa~e~il~~c~~~~~~~~  441 (885)
T 3b8c_A          362 AAMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHRVSKGAPEQILELAKASNDLSK  441 (885)
T ss_dssp             HHHHCCSSSCCSHHHHHHHTTCCTTCCCCSSCCBCCCCCCTTTCCCCCBBCSSSSCBCBCCCCSGGGTSSSSCCCSTTTT
T ss_pred             HHHHhCCCCCCchHHHHHHHhhchhhHhhcCceeecccCCcccceEEEEEEecCCcEEEEEeCCHHHHHHhccCchhhHH
Confidence            45566666899999999999887666677899999999999999999988877888889999999999999987666677


Q ss_pred             HHHHHHHHHHHccCcceeeeeeccCCCCcCCCCCCceEEEEEeccCCCCcchHHHHHHHHhCCCcEEEeCCCcHHHHHHH
Q 015327           82 KVNAVINKFAERGLRSLAVAYQEVPEGSKESSGSPWQFIGLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKET  161 (409)
Q Consensus        82 ~~~~~i~~~a~~GlR~l~~a~~~~~~~~~~~~e~~l~~lG~i~l~d~lr~~~~~~I~~l~~aGi~v~mlTGD~~~ta~~i  161 (409)
                      .+.+.+++|+++|+|++++|++++++.+.+..|++++|+|+++++|||||+++++|+.|+++||+|+|+|||+..||.++
T Consensus       442 ~~~~~~~~~a~~G~rvl~vA~~~~~~~~~~~~e~~l~~lGli~i~Dp~R~~a~~aI~~l~~aGI~v~MiTGD~~~tA~~i  521 (885)
T 3b8c_A          442 KVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKET  521 (885)
T ss_dssp             THHHHHHHHTTTTCEEEEECCBCCCSSSSSCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHTTCCCEEEESSCHHHHTHH
T ss_pred             HHHHHHHHHHhCCCeEEEEEEeccccccccccccCcEEEEEEEeecccchhHHHHHHHHHHcCCcEEEEcCCChHHHHHH
Confidence            78899999999999999999999887777778899999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCCCCCCCCccccCcchhhhhhcCChhHHhhhccceeecCHhhHHHHHHHHHhCCCEEEEEcCCcCCHHHHhhCCe
Q 015327          162 GRRLGMGTNMYPSSALSGQDRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKADI  241 (409)
Q Consensus       162 a~~lgi~~~~~~~~~l~g~~~~~~~~~~~~~~~~~~~~v~ar~~P~~K~~iV~~lq~~g~~v~~iGDG~ND~~aLk~Adv  241 (409)
                      |+++||..+..+...+.|.+.+..+...+++++++++.+|+|++|+||.++|+.+|+.|+.|+|+|||+||+|||+.|||
T Consensus       522 A~~lGi~~~~~~~~~l~g~~~~~~~~~~~l~~~~~~~~v~arv~P~~K~~iV~~lq~~g~~Vam~GDGvNDapaLk~Adv  601 (885)
T 3b8c_A          522 GRRLGMGTNMYPSSALLGTHKDANLASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  601 (885)
T ss_dssp             HHTTTCTTCCSTTSSCCBGGGGTTSCCSCHHHHHHTSCCEECCCHHHHHHHHHHHHHTTCCCCBCCCSSTTHHHHHHSSS
T ss_pred             HHHhCCccccCCcceeeccccccccchhHHHHHHhhCcEEEEECHHHHHHHHHHHHHCCCeEEEEcCCchhHHHHHhCCE
Confidence            99999987666666777877766566777888999999999999999999999999999999999999999999999999


Q ss_pred             eEEeccchHHHhhccCEEecCCChhhHHHHHHHHHHHHHHHHHHHHHHH-hhhHHHHHHHHhhhhhhccHHHHHHHHHHh
Q 015327          242 GIAVADATDAARSAADIVLTEPGLNVIITAVLISRAIFQRMRNYMVRGI-DGLSSTEFIQVLELNFLFTLDTVIAILQTA  320 (409)
Q Consensus       242 GIa~~~~~~~a~~aaDivl~~~~l~~i~~~i~~gR~~~~~i~~~~~~~~-~~i~~~~~~~~~~~~~~~pl~~~~~l~~~~  320 (409)
                      ||||++++++|+++||+|+.+++|.+|++++.+||++|+||++++.|.+ .++..++.+....+.+.+|+.++++++..+
T Consensus       602 GIAmg~gtd~ak~aADivl~~~~~~~I~~ai~~gR~~~~ni~~~i~~~l~~n~~~~~~~~~~~~~~~~~l~p~~il~i~l  681 (885)
T 3b8c_A          602 GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAI  681 (885)
T ss_dssp             CCCCSSSHHHHGGGCSSCCSSCSHHHHTHHHHTHHHHHHHHHHHHHHHHHHTTTTTSTTHHHHSSCSSCSCHHHHHHHHH
T ss_pred             eEEeCCccHHHHHhcceeeccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCcCcCHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999 444222222222223446788888873333


Q ss_pred             ccccccchhh
Q 015327          321 FTSKKDFGKE  330 (409)
Q Consensus       321 ~t~~~~~~~~  330 (409)
                      ++..+.+.++
T Consensus       682 ~~d~~~l~l~  691 (885)
T 3b8c_A          682 LNDGTIMTIS  691 (885)
T ss_dssp             HHHTTTCCCC
T ss_pred             HHHHHHHhhc
Confidence            3333334443



>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2o98_P H-ATPase PMA2, plasma membrane H+ ATPase; 14-3-3, electrochemical proton G cell turgor, regulation, protein binding; HET: FSC; 2.70A {Nicotiana plumbaginifolia} Back     alignment and structure
>3m50_P N.plumbaginifolia H+-translocating ATPase mRNA; all helical, protein-protein complex, protein binding; HET: EBT; 2.60A {Nicotiana plumbaginifolia} PDB: 3m51_P* 4dx0_P* Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>1svj_A Potassium-transporting ATPase B chain; alpha-beta sandwich, hydrolase; NMR {Escherichia coli} SCOP: d.220.1.1 PDB: 1u7q_A 2a00_A* 2a29_A* Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 409
d1wpga2168 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, ca 2e-29
d1qyia_380 c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 1e-21
d2b8ea1135 c.108.1.7 (A:416-434,A:548-663) Cation-transportin 1e-19
d1q3ia_214 d.220.1.1 (A:) Sodium/potassium-transporting ATPas 2e-12
d2feaa1226 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio 4e-09
d1k1ea_177 c.108.1.5 (A:) Probable phosphatase YrbI {Haemophi 1e-08
d1wr8a_230 c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa 5e-08
d1nnla_217 c.108.1.4 (A:) Phosphoserine phosphatase {Human (H 7e-08
d1j97a_210 c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon 9e-08
d1l6ra_225 c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa 3e-07
d1rkua_206 c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomona 6e-07
d2b30a1283 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmod 9e-07
d1wpga3239 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryc 3e-06
d2rbka1260 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase B 1e-05
d1rkqa_271 c.108.1.10 (A:) Hypothetical protein YidA {Escheri 1e-05
d1nf2a_267 c.108.1.10 (A:) Hypothetical protein TM0651 {Therm 2e-05
d1nrwa_285 c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillu 2e-05
d1rlma_269 c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Esc 3e-05
d1s2oa1244 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 { 0.002
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 168 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Meta-cation ATPase, catalytic domain P
domain: Calcium ATPase, catalytic domain P
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
 Score =  110 bits (275), Expect = 2e-29
 Identities = 55/156 (35%), Positives = 81/156 (51%), Gaps = 1/156 (0%)

Query: 118 QFIGLIPLFDPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGM-GTNMYPSSA 176
                    DPP  +   +I+     G+ V MITGD    A    RR+G+ G N   +  
Sbjct: 10  TGTLTTNQLDPPRKEVMGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADR 69

Query: 177 LSGQDRDESIVALPVDELIEKADGFAGVFPEHKYEIVKHLQARNHICGMIGNGVNDAPAL 236
                  + +      E   +A  FA V P HK +IV++LQ+ + I  M G+GVNDAPAL
Sbjct: 70  AYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPAL 129

Query: 237 KKADIGIAVADATDAARSAADIVLTEPGLNVIITAV 272
           KKA+IGIA+   T  A++A+++VL +   + I+ AV
Sbjct: 130 KKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAV 165


>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 Back     information, alignment and structure
>d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} Length = 214 Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Length = 177 Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 210 Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Length = 206 Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Length = 283 Back     information, alignment and structure
>d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 239 Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 260 Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Length = 267 Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Length = 285 Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Length = 269 Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 244 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query409
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 100.0
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 99.96
d1q3ia_214 Sodium/potassium-transporting ATPase alpha chain { 99.9
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.9
d1wpga3239 Calcium ATPase {Rabbit (Oryctolagus cuniculus) [Ta 99.75
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.44
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.38
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.31
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 99.27
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.25
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 99.24
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 99.2
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.2
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.17
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.12
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.11
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 99.11
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 99.06
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.87
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.78
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 98.74
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 98.24
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 98.18
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 98.11
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 98.06
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 98.02
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 97.93
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 97.86
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 97.56
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 97.54
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 97.54
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 97.51
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.35
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 97.32
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 97.23
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 97.1
d2a29a1136 Potassium-transporting ATPase B chain, KdpB {Esche 97.1
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 96.98
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 96.79
d1wpga4 472 Calcium ATPase, transmembrane domain M {Rabbit (Or 96.48
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 96.38
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 96.3
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 96.28
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 96.25
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 96.14
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 95.96
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 95.92
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 95.83
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 95.81
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 95.79
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 95.65
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 95.64
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 95.17
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 94.48
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 93.8
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 90.51
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Meta-cation ATPase, catalytic domain P
domain: Calcium ATPase, catalytic domain P
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Probab=100.00  E-value=3.5e-34  Score=252.02  Aligned_cols=148  Identities=38%  Similarity=0.531  Sum_probs=130.2

Q ss_pred             CCCCcchHHHHHHHHhCCCcEEEeCCCcHHHHHHHHHHhCCCCCCCC--CccccCcchhhhhhcCChhHHhhhccceeec
Q 015327          127 DPPIHDSAETIRRALSLGLGVKMITGDQLAIAKETGRRLGMGTNMYP--SSALSGQDRDESIVALPVDELIEKADGFAGV  204 (409)
Q Consensus       127 d~lr~~~~~~I~~l~~aGi~v~mlTGD~~~ta~~ia~~lgi~~~~~~--~~~l~g~~~~~~~~~~~~~~~~~~~~v~ar~  204 (409)
                      ||||++++++|+.|+++||+|||+|||+..||.++|+++||..+...  ...+.|.+++ .....+..+..++..+|+|+
T Consensus        19 Dp~R~~~~~~I~~l~~~GI~v~miTGD~~~tA~~ia~~~Gi~~~~~~v~~~~~~~~~~~-~~~~~~~~~~~~~~~v~ar~   97 (168)
T d1wpga2          19 DPPRKEVMGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFD-DLPLAEQREACRRACCFARV   97 (168)
T ss_dssp             CCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHTTSSCTTCCCTTTEEEHHHHH-HSCHHHHHHHHHHCCEEESC
T ss_pred             CCCchhHHHHHHHHHHCcCEEEEECCCCHHHHHHHHHHcCCCCCccccccccccccccc-hhhHHHHhhhhhhhhhhhcc
Confidence            99999999999999999999999999999999999999999765322  2233343332 12223345667888999999


Q ss_pred             CHhhHHHHHHHHHhCCCEEEEEcCCcCCHHHHhhCCeeEEeccchHHHhhccCEEecCCChhhHHHHHHHH
Q 015327          205 FPEHKYEIVKHLQARNHICGMIGNGVNDAPALKKADIGIAVADATDAARSAADIVLTEPGLNVIITAVLIS  275 (409)
Q Consensus       205 ~P~~K~~iV~~lq~~g~~v~~iGDG~ND~~aLk~AdvGIa~~~~~~~a~~aaDivl~~~~l~~i~~~i~~g  275 (409)
                      +|+||..+|+.+|+.|++|+|+|||.||+|||+.|||||+++++++.|+++||+++.+++|..|.++|+||
T Consensus        98 ~p~~K~~lv~~l~~~g~~Va~vGDG~nD~~AL~~AdvGIa~~~gt~~a~~aAdivl~~~~l~~v~~~I~~G  168 (168)
T d1wpga2          98 EPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEG  168 (168)
T ss_dssp             CHHHHHHHHHHHHHTTCCEEEEECSGGGHHHHHHSSEEEEETTSCHHHHHTCSEEETTCCTHHHHHHHHHH
T ss_pred             chhHHHHHHHHHHhcccceeEEecCCCCHHHHHhCCEEEEeccccHHHHHhCCEEEccCCHHHHHHHHHcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999997



>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a29a1 d.220.1.1 (A:316-451) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure