Citrus Sinensis ID: 015340

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41

MLQMHLSSSFSLKYHPLQKAGCIKTLESPVTHIHGVLNRSQEKKYAIKCSQSNSFYNLTNKIASSRNCKPFNSHRAPVTLQDGYASKSEDDDHSNSFLNVFLKKFHALYRFMRAYACAGVIIATTSNSLLPVQTLADLTPAYFTGLMEALVPAVLMHIYVVAINQLSDVEVDKVNKPYLPLASGEISMGTGIAITLASALMSLAYAVMIRSPPFIWAVIAWIFVGTAYSVQLPLLRWKGNSFLAAFCMVSLNGLLTQFPVYVHIQKYVLGRPLEIFTRPLMFATAFISCFCVVIAFIKDLHDVDGDKKFGIKTLSVMLGKERLFFPQKVFRLSVSMLSIAYGAAVVVGASSPFLANKLITIIGHGILASIFWLRVRAVDLSDNASILSFYMFIWKLYYAEYLLIPFVR

cccccccccEEEccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccc

***********LKYHPLQKAGCIKTLESPVTHIHGVLNRSQEKKYAIKCSQSNSFYNLTNKI*********************************SFLNVFLKKFHALYRFMRAYACAGVIIATTSNSLLPVQTLADLTPAYFTGLMEALVPAVLMHIYVVAINQLSDVEVDKVNKPYLPLASGEISMGTGIAITLASALMSLAYAVMIRSPPFIWAVIAWIFVGTAYSVQLPLLRWKGNSFLAAFCMVSLNGLLTQFPVYVHIQKYVLGRPLEIFTRPLMFATAFISCFCVVIAFIKDLHDVDGDKKFGIKTLSVMLGKERLFFPQKVFRLSVSMLSIAYGAAVVVGASSPFLANKLITIIGHGILASIFWLRVRAVDLSDNASILSFYMFIWKLYYAEYLLIPFVR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable homogentisate phytyltransferase 1, chloroplastic	Involved in the synthesis of tocopherol (vitamin E). Catalyzes the condensation of homogentisate and phytyl diphosphate to form dimethylphytylhydroquinone.	probable	B7FA90

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted