Citrus Sinensis ID: 015342


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MFLFSFVTYYTSSLLTDCYRTADPVFGKRNYTYMDAVRSILGGAKVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFGVMEIFLSQIPDFDQIWWLSIVAAVMSFTYSAIGLALGIVQVAANGAFKGSLTGISIGTVTQTQKIWRSFQALGDIAFAYSYSVILIEIQDTLKSPPAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGLLPYKLNLFRLVWRSCFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSMACLVLSIIAGAGSIVGVVNDVKAYTPFKTTY
ccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHEEEEEEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccEEEEEEHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
MFLFSFVTYYTSSLLTDCYRTADPVFGKRNYTYMDAVRSILGGAKVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFGVMEIFLSQIPDFDQIWWLSIVAAVMSFTYSAIGLALGIVQVAANGAFKGSLTGISIGTVTQTQKIWRSFQALGDIAFAYSYSVILIEIQDTLKSPPAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGLLPYKLNLFRLVWRSCFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSMACLVLSIIAGAGSIVGVVNDVKAYTPFKTTY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLFSFVTYYTSSLLTDCYRTADPVFGKRNYTYMDAVRSILGGAKVKACGLIQYLNLFGIAIGYTIAASISMMAIKRSNCFHESGGNNPCHMSSNPYMILFGVMEIFLSQIPDFDQIWWLSIVAAVMSFTYSAIGLALGIVQVAANGAFKGSLTGISIGTVTQTQKIWRSFQALGDIAFAYSYSVILIEIQDTLKSPPAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGLLPYKLNLFRLVWRSCFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSMACLVLSIIAGAGSIVGVVNDVKAYTPFKTTY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Amino acid permease 2 Amino acid-proton symporter. Stereospecific transporter with a broad specificity for histidine, arginine, glutamate and neutral amino acids, favoring small amino acids such as alanine, asparagine and glutamine. Accepts also large aromatic residues such as in phenlalanine or tyrosine. Has a much higher affinity for basic amino acids as compared with AAP1. May function in xylem-to-phloem transfer and in uptake of amino acids assimilated in the green silique tissue.confidentQ38967
Amino acid permease 4 Amino acid-proton symporter. Stereospecific transporter with a broad specificity for neutral amino acids, favoring small amino acids such as alanine, asparagine and glutamine. Accepts also large aromatic residues such as in phenlalanine or tyrosine.probableQ9FN04
Amino acid permease 3 Amino acid-proton symporter. Stereospecific transporter with a broad specificity for GABA, tryptophan and both neutral and basic amino acids. High affinity transport of cationic amino acids.probableQ39134

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:probable
Coverage over the Query: 3-155,169-233
View the alignment between query and template
View the model in PyMOL