Citrus Sinensis ID: 015350


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MMRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQLIKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLAQKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYGVPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICREEMTTAKKLICGHLFHVHCLRSWLERQHTCPTCRALVVPPENGASTAGVQHGQRPDTHQSGTATANTASQGSANDAANNNLTLHQARLQAAAVAASVYGKSYVYPSPNTLVW
ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEcccccccEEEcccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHEccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccccEEEEcHHcccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEccccccccc
mmrlqtyagfSFMATLAVVYHAFnsrrqfypSMVYLSTSKISLVLLMNMGLVIMCILWQLIKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLAQKRVEYiettptvpllSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYGVPLHLIRELYETFRNFRIRVADYVRYRKITsnmndrfpdaspeeldasdstCIICREEMTTAKKLICGHLFHVHCLRSWLerqhtcptcralvvppengastagvqhgqrpdthqsgtatantasqgsandaannNLTLHQARLQAAAVAASVYgksyvypspntlvw
MMRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQLIKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLAQKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYGVPLHLIRELYETFRNFRIRVADYVRYRKItsnmndrfpdaspeeldasdSTCIICREEMTTAKKLICGHLFHVHCLRSWLERQHTCPTCRALVVPPENGASTAGVQHGQRPDTHQSGTATANTASQGSANDAANNNLTLHQARLQAAAVAASVYGKsyvypspntlvw
MMRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQLIKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLAQKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYGVPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICREEMTTAKKLICGHLFHVHCLRSWLERQHTCPTCRALVVPPENGASTAGVQHGQRPDTHQSGTATANTASQGSANDAANNNLTLHQARLQaaavaasvygksyvyPSPNTLVW
****QTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQLIKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLAQKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYGVPLHLIRELYETFRNFRIRVADYVRYRKITS******************STCIICREEMTTAKKLICGHLFHVHCLRSWLERQHTCPTCRALVV********************************************LHQARLQAAAVAASVYGKSYVYP*******
*MRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQLIKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLAQKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYGVPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICREEMTTAKKLICGHLFHVHCLRSWLERQHTCPTCRALV*********************************************************************PNTLV*
MMRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQLIKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLAQKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYGVPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICREEMTTAKKLICGHLFHVHCLRSWLERQHTCPTCRALVVPPENG*****************************ANDAANNNLTLHQARLQAAAVAASVYGKSYVYPSPNTLVW
MMRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQLIKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLAQKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYGVPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICREEMTTAKKLICGHLFHVHCLRSWLERQHTCPTCRALVV*****************************************************AVAASVYGKSYVYPSPNTLVW
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQLIKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLAQKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYGVPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICREEMTTAKKLICGHLFHVHCLRSWLERQHTCPTCRALVVPPENGASTAGVQHGQRPDTHQSGTATANTASQGSANDAANNNLTLHQARLQAAAVAASVYGKSYVYPSPNTLVW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query408 2.2.26 [Sep-21-2011]
Q9DBY1 612 E3 ubiquitin-protein liga yes no 0.806 0.537 0.447 1e-77
Q86TM6 617 E3 ubiquitin-protein liga yes no 0.806 0.533 0.447 1e-77
Q803I8 625 E3 ubiquitin-protein liga yes no 0.806 0.526 0.432 2e-76
Q5XHH7 595 E3 ubiquitin-protein liga N/A no 0.786 0.539 0.433 2e-73
Q6NRL6 605 E3 ubiquitin-protein liga N/A no 0.786 0.530 0.433 5e-73
Q95SP2 626 E3 ubiquitin-protein liga yes no 0.857 0.559 0.392 2e-72
A8Y4B2 622 E3 ubiquitin-protein liga N/A no 0.786 0.516 0.409 3e-69
Q20798 610 E3 ubiquitin-protein liga yes no 0.786 0.526 0.409 3e-69
O74757 677 ERAD-associated E3 ubiqui yes no 0.889 0.536 0.293 6e-42
Q9UKV5 643 E3 ubiquitin-protein liga no no 0.723 0.458 0.285 6e-32
>sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 Back     alignment and function desciption
 Score =  290 bits (743), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 148/331 (44%), Positives = 202/331 (61%), Gaps = 2/331 (0%)

Query: 1   MMRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQL 60
           M R       S   T AVV HA+  + QFYP++VYL+ S  S+ +L     V++ +L ++
Sbjct: 1   MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKV 60

Query: 61  IKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLA 120
           + KVF G LR AE+E L E+S   + E   A T+FR DFS  F+A+ T LL +K  HWLA
Sbjct: 61  MGKVFFGQLRAAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLA 120

Query: 121 QKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYM 180
           + RV+++E +P +  L H RIVS M  L ++D LF+  +   +L TR ASV L F FEY 
Sbjct: 121 EDRVDFMERSPNISWLFHCRIVSLMFLLGILDFLFVSHAYHSIL-TRGASVQLVFGFEYA 179

Query: 181 ILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYG 240
           IL T  ++IF+KYV +  D+  E  W+ KAVY  Y EL    + + +Y+ F  ++   + 
Sbjct: 180 ILMTMVLTIFIKYVLHSVDLQSENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHT 239

Query: 241 VPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICREEMT 300
            PL  IR +Y   R F+  V D +  R+   NMN  +PDA+PEEL A D+ CIICREEM 
Sbjct: 240 FPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAVDNVCIICREEMV 299

Query: 301 T-AKKLICGHLFHVHCLRSWLERQHTCPTCR 330
           T AK+L C H+FH  CLRSW +RQ TCPTCR
Sbjct: 300 TGAKRLPCNHIFHTSCLRSWFQRQQTCPTCR 330




Acts as an E3 ubiquitin-protein ligase which accepts ubiquitin specifically from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, promoting their degradation. Component of the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Also promotes the degradation of normal but naturally short-lived proteins such as SGK. Protects cells from ER stress-induced apoptosis. Sequesters p53/TP53 in the cytoplasm and promotes its degradation, thereby negatively regulating its biological function in transcription, cell cycle regulation and apoptosis. Required for embryogenesis.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 Back     alignment and function description
>sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 Back     alignment and function description
>sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 Back     alignment and function description
>sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 Back     alignment and function description
>sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 Back     alignment and function description
>sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 Back     alignment and function description
>sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 Back     alignment and function description
>sp|O74757|HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrd1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UKV5|AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens GN=AMFR PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
359489894504 PREDICTED: E3 ubiquitin-protein ligase s 0.992 0.803 0.843 0.0
224126659439 predicted protein [Populus trichocarpa] 1.0 0.929 0.845 0.0
224112755408 predicted protein [Populus trichocarpa] 1.0 1.0 0.813 0.0
255557983 536 protein binding protein, putative [Ricin 1.0 0.761 0.843 0.0
357481129 539 E3 ubiquitin-protein ligase synoviolin [ 0.992 0.751 0.800 0.0
449442867 558 PREDICTED: E3 ubiquitin-protein ligase s 0.997 0.729 0.794 0.0
449525567501 PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu 0.997 0.812 0.794 0.0
357474249 646 E3 ubiquitin-protein ligase synoviolin [ 0.987 0.623 0.789 0.0
297830190502 zinc finger family protein [Arabidopsis 1.0 0.812 0.782 0.0
357474267 671 E3 ubiquitin-protein ligase synoviolin [ 0.987 0.600 0.789 0.0
>gi|359489894|ref|XP_002274331.2| PREDICTED: E3 ubiquitin-protein ligase synoviolin-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/408 (84%), Positives = 379/408 (92%), Gaps = 3/408 (0%)

Query: 1   MMRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQL 60
           M++LQTYAG S +ATLAV+YHAFNSR QFYP+ VYLSTSKISLVLL+NMGLVIMCILWQL
Sbjct: 1   MIKLQTYAGLSLVATLAVIYHAFNSRGQFYPATVYLSTSKISLVLLLNMGLVIMCILWQL 60

Query: 61  IKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLA 120
            K+VFLGSLREAEVERLNEQS RE+MEILFAITIFRQDFSV+FLAMVT LLLIKALHWLA
Sbjct: 61  TKRVFLGSLREAEVERLNEQSWREVMEILFAITIFRQDFSVTFLAMVTALLLIKALHWLA 120

Query: 121 QKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYM 180
           QKRVEYIETTP+VP+LSHIRIVSFM FLL++DSLFLYSS+K+L+QTRQASVSL FSFEYM
Sbjct: 121 QKRVEYIETTPSVPMLSHIRIVSFMGFLLILDSLFLYSSLKYLIQTRQASVSLLFSFEYM 180

Query: 181 ILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYG 240
           ILATTTVS FVKYVFYVSDMLMEGQWE+KAVYTFYLELIRDLLHLS+YLCFFLVIFMNYG
Sbjct: 181 ILATTTVSTFVKYVFYVSDMLMEGQWEKKAVYTFYLELIRDLLHLSLYLCFFLVIFMNYG 240

Query: 241 VPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICREEMT 300
           VPLHLIRELYETFRNFR+R+ADY+RYRK+TSNMNDRFPDA+PEELDASD+TCIICREEM 
Sbjct: 241 VPLHLIRELYETFRNFRVRIADYIRYRKMTSNMNDRFPDATPEELDASDATCIICREEMV 300

Query: 301 TAKKLICGHLFHVHCLRSWLERQHTCPTCRALVVPPENGASTAGVQHGQRPDTHQSGTAT 360
           TAKKLICGHLFH+HCLRSWLERQHTCPTCRALVVPPENG +TAG QHG R D HQ     
Sbjct: 301 TAKKLICGHLFHMHCLRSWLERQHTCPTCRALVVPPENGTTTAGGQHGPRSDFHQ---GN 357

Query: 361 ANTASQGSANDAANNNLTLHQARLQAAAVAASVYGKSYVYPSPNTLVW 408
           A+T++QG   D A++NL  H+ARLQAAA AA++Y KS+VYPSPNTLVW
Sbjct: 358 ASTSTQGLTGDVADDNLNWHRARLQAAASAAAIYEKSFVYPSPNTLVW 405




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224126659|ref|XP_002319894.1| predicted protein [Populus trichocarpa] gi|222858270|gb|EEE95817.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112755|ref|XP_002332720.1| predicted protein [Populus trichocarpa] gi|222832883|gb|EEE71360.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255557983|ref|XP_002520020.1| protein binding protein, putative [Ricinus communis] gi|223540784|gb|EEF42344.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357481129|ref|XP_003610850.1| E3 ubiquitin-protein ligase synoviolin [Medicago truncatula] gi|355512185|gb|AES93808.1| E3 ubiquitin-protein ligase synoviolin [Medicago truncatula] Back     alignment and taxonomy information
>gi|449442867|ref|XP_004139202.1| PREDICTED: E3 ubiquitin-protein ligase synoviolin-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449525567|ref|XP_004169788.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase synoviolin-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|357474249|ref|XP_003607409.1| E3 ubiquitin-protein ligase synoviolin [Medicago truncatula] gi|355508464|gb|AES89606.1| E3 ubiquitin-protein ligase synoviolin [Medicago truncatula] Back     alignment and taxonomy information
>gi|297830190|ref|XP_002882977.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297328817|gb|EFH59236.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357474267|ref|XP_003607418.1| E3 ubiquitin-protein ligase synoviolin [Medicago truncatula] gi|355508473|gb|AES89615.1| E3 ubiquitin-protein ligase synoviolin [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
TAIR|locus:2093422492 Hrd1A "homolog of yeast Hrd1" 0.990 0.821 0.757 1.2e-163
TAIR|locus:2014993460 Hrd1B "homolog of yeast Hrd1" 1.0 0.886 0.712 2.9e-158
UNIPROTKB|Q86TM6 617 SYVN1 "E3 ubiquitin-protein li 0.865 0.572 0.426 5.9e-76
UNIPROTKB|E2RSJ2 776 SYVN1 "Uncharacterized protein 0.806 0.423 0.447 9.6e-76
UNIPROTKB|E1BAK9 611 SYVN1 "Uncharacterized protein 0.865 0.577 0.426 1.6e-75
UNIPROTKB|I3LGG8 610 SYVN1 "Uncharacterized protein 0.806 0.539 0.444 6.7e-75
MGI|MGI:1921376 612 Syvn1 "synovial apoptosis inhi 0.865 0.576 0.426 2.8e-73
UNIPROTKB|Q5XHH7 595 syvn1-b "E3 ubiquitin-protein 0.786 0.539 0.433 5.3e-73
ZFIN|ZDB-GENE-030131-7166 625 syvn1 "synovial apoptosis inhi 0.857 0.56 0.417 1.2e-72
UNIPROTKB|Q6NRL6 605 syvn1-a "E3 ubiquitin-protein 0.786 0.530 0.436 7.7e-71
TAIR|locus:2093422 Hrd1A "homolog of yeast Hrd1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1593 (565.8 bits), Expect = 1.2e-163, P = 1.2e-163
 Identities = 313/413 (75%), Positives = 352/413 (85%)

Query:     1 MMRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMCILWQL 60
             M+RL+TYAG SFMATLAV+YHAF+SR QFYP+ VYLSTSKISLVLL+NM LV+M  LW L
Sbjct:     1 MIRLRTYAGLSFMATLAVIYHAFSSRGQFYPATVYLSTSKISLVLLLNMCLVLMLSLWHL 60

Query:    61 IKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLA 120
             +K VFLGSLREAEVERLNEQ+ RE+MEILFAITIFRQDFS  FL +V TLLLIKALHWLA
Sbjct:    61 VKFVFLGSLREAEVERLNEQAWRELMEILFAITIFRQDFSSGFLPLVVTLLLIKALHWLA 120

Query:   121 QKRVEYIETTPTVPLLSHIRIVSFMSFLLLVDSLFLYSSVKFLLQTRQASVSLFFSFEYM 180
             QKRVEYIETTP+V  LSH RIVSFM FLLLVDSLF+YSS++ L+Q+RQASVSLFFSFEYM
Sbjct:   121 QKRVEYIETTPSVSKLSHFRIVSFMGFLLLVDSLFMYSSIRHLIQSRQASVSLFFSFEYM 180

Query:   181 ILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMNYG 240
             ILATTTV+IFVKYVFYV+DMLM+GQWE+K VYTFYLELIRDLLHLSMY+CFF VIFMNYG
Sbjct:   181 ILATTTVAIFVKYVFYVTDMLMDGQWEKKPVYTFYLELIRDLLHLSMYICFFFVIFMNYG 240

Query:   241 VPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICREEMT 300
             VPLHL+RELYETFRNF+IRV+DY+RYRKITSNMNDRFPDA+PEEL ASD+TCIICREEMT
Sbjct:   241 VPLHLLRELYETFRNFQIRVSDYLRYRKITSNMNDRFPDATPEELTASDATCIICREEMT 300

Query:   301 TAKKLICGHLFHVHCLRSWLERQHTCPTCRALVVPPENGASTAGVQHGQRPDTHQ-SGTA 359
              AKKLICGHLFHVHCLRSWLERQ TCPTCRALVVPPEN  S A    GQR + HQ S   
Sbjct:   301 NAKKLICGHLFHVHCLRSWLERQQTCPTCRALVVPPENATSAAP---GQR-ELHQGSQQG 356

Query:   360 TANTASQGS--ANDA--ANNNLTLHQARLQXXXXXXXXXXXXXXXPSPNTLVW 408
             T+++ +QGS  ++ A  +NN+L+ H ARLQ               PS NT+ W
Sbjct:   357 TSSSGNQGSEISSSAGVSNNSLSRHHARLQAAASAASVYGKSMVYPSANTVAW 409




GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0030433 "ER-associated protein catabolic process" evidence=IMP
GO:0008295 "spermidine biosynthetic process" evidence=RCA
TAIR|locus:2014993 Hrd1B "homolog of yeast Hrd1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q86TM6 SYVN1 "E3 ubiquitin-protein ligase synoviolin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSJ2 SYVN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAK9 SYVN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LGG8 SYVN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1921376 Syvn1 "synovial apoptosis inhibitor 1, synoviolin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XHH7 syvn1-b "E3 ubiquitin-protein ligase synoviolin B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7166 syvn1 "synovial apoptosis inhibitor 1, synoviolin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NRL6 syvn1-a "E3 ubiquitin-protein ligase synoviolin A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XIII000461
hypothetical protein (439 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XIV.3461.1
hypothetical protein (303 aa)
       0.800
gw1.166.113.1
SubName- Full=Putative uncharacterized protein; (304 aa)
       0.800
eugene3.00160841
hypothetical protein (803 aa)
       0.800
eugene3.00120808
hypothetical protein (800 aa)
       0.800
eugene3.00110107
hypothetical protein (305 aa)
       0.800
eugene3.00001956
SubName- Full=Putative uncharacterized protein; (411 aa)
       0.800
estExt_fgenesh4_pm.C_280088
hypothetical protein (810 aa)
       0.800
estExt_fgenesh4_pg.C_LG_XV0552
hypothetical protein (814 aa)
       0.800
estExt_Genewise1_v1.C_LG_VIII0851
hypothetical protein (136 aa)
       0.800
estExt_Genewise1_v1.C_LG_II3659
SubName- Full=Putative uncharacterized protein; (255 aa)
       0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 3e-53
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 6e-15
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 9e-14
cd0016245 cd00162, RING, RING-finger (Really Interesting New 5e-13
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-10
smart0018440 smart00184, RING, Ring finger 4e-10
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 2e-09
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 6e-07
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 8e-07
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 3e-06
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 3e-05
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 5e-04
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 5e-04
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 0.002
COG5236 493 COG5236, COG5236, Uncharacterized conserved protei 0.003
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 0.003
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  184 bits (467), Expect = 3e-53
 Identities = 128/438 (29%), Positives = 204/438 (46%), Gaps = 43/438 (9%)

Query: 2   MRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLSTSKISLVLLMNMGLVIMC---ILW 58
           MR   Y   S +     V  +  S    Y ++V   TS++S V +     VI+    ++ 
Sbjct: 1   MRFILYVLASLVLFGLSVLLSLYSSATVYSALV--MTSQLSPVHITIGLNVILLLFFLIA 58

Query: 59  QLIKKVFLGSLREAEVERLNEQSRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHW 118
             +K +  GSLR  E+E L EQ    + EIL AI++FR+  S SF  +++TLL  K  HW
Sbjct: 59  NALKTLLFGSLRTFELELLYEQLWITLTEILLAISVFREAISFSFFMLLSTLLFAKVFHW 118

Query: 119 LAQKRVEYIETTPTVPLLSHIRIVSFMSFLL-LVDSLFLYSSVKFLLQTRQASVSLFF-S 176
           +   R E ++   T          S   FLL ++D+  +Y  +       ++++ LF   
Sbjct: 119 ILSFRTERLQIQSTDQRFHIFSRFSCAYFLLSILDASLIYLCISSEHLIDKSTLFLFVCE 178

Query: 177 FEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIF 236
           F  ++L  T+ +  +    Y +    +     ++ Y F LE+  D L L  Y   F+  F
Sbjct: 179 FSVLLLNLTSEANKLCVYNYEARDDDD----ERSTYLFRLEVCYDGLTLLAYSLLFMYQF 234

Query: 237 MNYGVPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICR 296
               VP++LIR++Y  F     R+ ++ R+R+ T ++N  +P A+ E+L  SD TC IC 
Sbjct: 235 PYVRVPIYLIRQMYTCFYALFRRIREHARFRRATKDLNAMYPTATEEQLTNSDRTCTICM 294

Query: 297 EEM-------------TTAKKLICGHLFHVHCLRSWLERQHTCPTCRALVVPPENGASTA 343
           +EM              T K+L CGH+ H+HCL++WLERQ TCP CR  V+  ++  + A
Sbjct: 295 DEMFHPDHEPLPRGLDMTPKRLPCGHILHLHCLKNWLERQQTCPICRRPVIFDQSSPTPA 354

Query: 344 GVQ------HGQRPDTHQSGTAT-----ANTASQG-----SANDAANNNLTLHQARLQAA 387
                      Q P+   + T T      N+++QG     + N   N N +   A  Q  
Sbjct: 355 SPNVRNTQIATQVPNPDNTPTTTAVPGITNSSNQGDPQASTFNGVPNANSSGFAAHTQD- 413

Query: 388 AVAASVYGKSYVYPSPNT 405
              +SV     + P P T
Sbjct: 414 --LSSVIPGWTMLPIPGT 429


Length = 491

>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227561 COG5236, COG5236, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 408
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 100.0
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 100.0
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.51
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.31
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.2
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.2
PHA02929238 N1R/p28-like protein; Provisional 99.17
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.12
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.11
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.03
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.97
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.93
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.9
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.85
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.84
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.79
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.75
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.75
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.74
PHA02926242 zinc finger-like protein; Provisional 98.69
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.66
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.62
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.6
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.54
PF1463444 zf-RING_5: zinc-RING finger domain 98.54
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.47
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.43
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.41
PF13705508 TRC8_N: TRC8 N-terminal domain 98.4
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.32
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.31
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.26
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.25
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.24
COG52191525 Uncharacterized conserved protein, contains RING Z 98.1
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 98.1
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.07
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.04
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.93
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.87
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.86
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.85
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.83
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.82
KOG1941518 consensus Acetylcholine receptor-associated protei 97.75
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.68
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.65
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.56
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.45
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.45
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.35
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 97.24
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.23
COG5222427 Uncharacterized conserved protein, contains RING Z 97.22
COG5152259 Uncharacterized conserved protein, contains RING a 97.22
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.16
KOG1002 791 consensus Nucleotide excision repair protein RAD16 97.15
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.13
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 97.13
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 97.03
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.01
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.84
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.83
KOG2660 331 consensus Locus-specific chromosome binding protei 96.79
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.65
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.31
KOG4445 368 consensus Uncharacterized conserved protein, conta 96.27
PHA02825162 LAP/PHD finger-like protein; Provisional 96.26
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.19
PHA02862156 5L protein; Provisional 96.16
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.02
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.8
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.71
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.43
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 95.42
KOG4367 699 consensus Predicted Zn-finger protein [Function un 95.32
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 94.87
COG5175 480 MOT2 Transcriptional repressor [Transcription] 94.86
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.83
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.59
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 94.45
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 94.44
PF10272358 Tmpp129: Putative transmembrane protein precursor; 94.02
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 93.98
KOG1001674 consensus Helicase-like transcription factor HLTF/ 93.72
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 93.59
PHA03096284 p28-like protein; Provisional 93.42
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 93.37
KOG4739 233 consensus Uncharacterized protein involved in syna 93.35
PF04641260 Rtf2: Rtf2 RING-finger 93.14
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 92.86
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 92.77
KOG1940276 consensus Zn-finger protein [General function pred 92.75
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 92.67
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 92.66
KOG0298 1394 consensus DEAD box-containing helicase-like transc 92.16
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 92.04
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 91.9
KOG3053 293 consensus Uncharacterized conserved protein [Funct 91.2
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 90.28
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 89.74
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 89.39
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 89.09
KOG3002 299 consensus Zn finger protein [General function pred 88.23
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 86.73
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 86.66
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 84.92
PRK12495226 hypothetical protein; Provisional 84.59
KOG03091081 consensus Conserved WD40 repeat-containing protein 83.18
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 83.18
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 83.08
KOG1609 323 consensus Protein involved in mRNA turnover and st 82.75
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 82.36
KOG2068327 consensus MOT2 transcription factor [Transcription 82.07
KOG3899381 consensus Uncharacterized conserved protein [Funct 80.9
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.8e-54  Score=404.35  Aligned_cols=334  Identities=32%  Similarity=0.551  Sum_probs=283.6

Q ss_pred             cchhHHHHHHHHHHHHHHHHHHHhcccchhhhhhhcc-CCchHHHHHHHHHHHHHHHHHHHHHHhcccCcHHHHHHHHHh
Q 015350            2 MRLQTYAGFSFMATLAVVYHAFNSRRQFYPSMVYLST-SKISLVLLMNMGLVIMCILWQLIKKVFLGSLREAEVERLNEQ   80 (408)
Q Consensus         2 ~~~~~y~~~s~~~~~~~v~~a~~~~~~fy~~~v~l~~-s~~~~~il~N~~~~~~~~~~~~~~~~~fG~Lr~~E~e~l~e~   80 (408)
                      ||..+|+..++++.+..++-++++..+-|++.+..++ |+.++++..|++++++.++|+++++++||+||..|.||++|+
T Consensus         1 ~r~i~y~l~~~Vl~~l~~~~~~~~s~t~ys~l~~t~~ls~~hi~i~~~~ill~~~l~~~~l~~llFGsLr~~E~e~~~E~   80 (491)
T COG5243           1 MRFILYVLASLVLFGLSVLLSLYSSATVYSALVMTSQLSPVHITIGLNVILLLFFLIANALKTLLFGSLRTFELELLYEQ   80 (491)
T ss_pred             CceeehhHHHHHHHHHHHHHHHhccceeeeeeeeeeccCcchhHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHh
Confidence            6889999999999999999999999999999999888 889999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHhccccchhHHHHHHHHHHHHHHHHHHHhhhhhcccccCCCCchHH--HHHHHHHHHHHHHHHHHHHH
Q 015350           81 SRREIMEILFAITIFRQDFSVSFLAMVTTLLLIKALHWLAQKRVEYIETTPTVPLLSH--IRIVSFMSFLLLVDSLFLYS  158 (408)
Q Consensus        81 ~~~~v~~~~~~~~if~~~~~~~~~~~~~~l~~lk~fh~l~~dR~e~l~~sp~~~~~~h--~R~~~~l~~ll~~d~~~~~~  158 (408)
                      +|++++|+++++++|++++++++..+++.|+++|+||||+++|+|-+. ..++....|  -|....+.+|.++|.-+++.
T Consensus        81 l~~tlt~~ll~iS~F~e~i~fs~~~l~~~Ll~~kvfhwil~~R~er~~-~~st~~~~~ifSrfS~~~~lL~ild~~li~~  159 (491)
T COG5243          81 LWITLTEILLAISVFREAISFSFFMLLSTLLFAKVFHWILSFRTERLQ-IQSTDQRFHIFSRFSCAYFLLSILDASLIYL  159 (491)
T ss_pred             hHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHhHHHHHH
Confidence            999999999999999999999999999999999999999999999543 234455555  37777778888999777777


Q ss_pred             HHHHHHhhCCchHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccccccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 015350          159 SVKFLLQTRQASVSLFFSFEYMILATTTVSIFVKYVFYVSDMLMEGQWERKAVYTFYLELIRDLLHLSMYLCFFLVIFMN  238 (408)
Q Consensus       159 ~~~~~~~~~~~~~~~~f~fE~~il~~~~l~~~~~y~~~~~d~~~~~~we~k~~~~~y~~l~~~~l~l~~~~~f~~~i~~~  238 (408)
                      |+....-.++...+ +|-+||-.+....-+...|-.++..|.+++.  +.|..+.|++|+..+-+.+..|..+++..+..
T Consensus       160 CiSs~~liD~~~lf-L~~c~F~~~ll~l~s~~n~~cV~n~~~~ddD--d~rs~~~f~~~v~y~g~tllays~l~~~~~~~  236 (491)
T COG5243         160 CISSEHLIDKSTLF-LFVCEFSVLLLNLTSEANKLCVYNYEARDDD--DERSTYLFRLEVCYDGLTLLAYSLLFMYQFPY  236 (491)
T ss_pred             HhhhHhhhhhhHHH-HHHHHHHHHHHHHHHhhcccceeeccccccc--ccceeeeeeeehHHHHHHHHHHHHHHHhhccc
Confidence            66521111222222 3444555443333333334455555665544  67788999999999999999999999999999


Q ss_pred             hcccHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhccCCCCCCcccccCCCCccccccccc-c------------CCeEE
Q 015350          239 YGVPLHLIRELYETFRNFRIRVADYVRYRKITSNMNDRFPDASPEELDASDSTCIICREEM-T------------TAKKL  305 (408)
Q Consensus       239 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~IC~~~~-~------------~~~~l  305 (408)
                      +++|++++++.|..+-.+.+|++.+.++++..|++++.++.++.|++.++|..|.||+|++ .            .|+++
T Consensus       237 ~r~Pi~l~r~~~t~~~AL~~~i~~~~~~~r~~kdl~~~~~t~t~eql~n~D~~C~ICmde~~h~~~~~~~~~~~~~pKrL  316 (491)
T COG5243         237 VRVPIYLIRQMYTCFYALFRRIREHARFRRATKDLNAMYPTATEEQLTNSDRTCTICMDEMFHPDHEPLPRGLDMTPKRL  316 (491)
T ss_pred             hhchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHhhcchhhhhhhcCCCCeEEEecccccCCCCccCcccccCCcccc
Confidence            9999999999999999999999999999999999999999999999999999999999995 3            35889


Q ss_pred             eecccccHhhHHHHHhcCCCCccccCcccCCCCC
Q 015350          306 ICGHLFHVHCLRSWLERQHTCPTCRALVVPPENG  339 (408)
Q Consensus       306 pC~H~Fh~~Cl~~wl~~~~~CP~Cr~~i~~~~~~  339 (408)
                      ||||.+|.+|++.|++++++||.||.++.-++.+
T Consensus       317 pCGHilHl~CLknW~ERqQTCPICr~p~ifd~~~  350 (491)
T COG5243         317 PCGHILHLHCLKNWLERQQTCPICRRPVIFDQSS  350 (491)
T ss_pred             cccceeeHHHHHHHHHhccCCCcccCccccccCC
Confidence            9999999999999999999999999997555444



>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF13705 TRC8_N: TRC8 N-terminal domain Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12495 hypothetical protein; Provisional Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 2e-06
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 3e-06
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 4e-05
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 4e-04
4ayc_B138 Rnf8 Ring Domain Structure Length = 138 6e-04
4ap4_A133 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 7e-04
4epo_C149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 7e-04
4ayc_A138 Rnf8 Ring Domain Structure Length = 138 8e-04
3ng2_A71 Crystal Structure Of The Rnf4 Ring Domain Dimer Len 8e-04
2xeu_A64 Ring Domain Length = 64 8e-04
2ea6_A69 Solution Structure Of The Ring Domain Of The Human 8e-04
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 2e-06, Method: Composition-based stats. Identities = 26/76 (34%), Positives = 33/76 (43%), Gaps = 17/76 (22%) Query: 278 PDASPEELDA--------------SDSTCIICREEMT---TAKKLICGHLFHVHCLRSWL 320 P AS E +DA + C IC E A +L C H FH C+ WL Sbjct: 15 PPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWL 74 Query: 321 ERQHTCPTCRALVVPP 336 ++ TCP CR + PP Sbjct: 75 QKSGTCPVCRCMFPPP 90
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4AP4|A Chain A, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 133 Back     alignment and structure
>pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure
>pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|3NG2|A Chain A, Crystal Structure Of The Rnf4 Ring Domain Dimer Length = 71 Back     alignment and structure
>pdb|2XEU|A Chain A, Ring Domain Length = 64 Back     alignment and structure
>pdb|2EA6|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 4 Length = 69 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-17
2ect_A78 Ring finger protein 126; metal binding protein, st 5e-17
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 5e-17
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 6e-17
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-16
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 7e-16
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-15
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-15
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-15
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 7e-15
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-14
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 3e-14
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 7e-14
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 9e-14
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 8e-13
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-12
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 1e-12
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-12
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 2e-12
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 3e-12
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 6e-12
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 8e-12
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 3e-11
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 9e-11
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 5e-10
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 9e-10
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-09
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 1e-09
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-09
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 2e-09
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-09
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-08
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-08
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-07
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 2e-07
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 2e-07
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-07
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 3e-07
3nw0_A238 Non-structural maintenance of chromosomes element 4e-07
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 4e-07
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 5e-07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 2e-06
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 3e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 5e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 1e-05
2ysl_A73 Tripartite motif-containing protein 31; ring-type 1e-05
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 4e-05
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 7e-05
2ea5_A68 Cell growth regulator with ring finger domain prot 2e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 2e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 3e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 3e-04
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 3e-04
2ysj_A63 Tripartite motif-containing protein 31; ring-type 3e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 5e-04
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 9e-04
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 9e-04
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
 Score = 74.2 bits (183), Expect = 3e-17
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 287 ASDSTCIICREEMTTAKKLI----CGHLFHVHCLRSWLERQHTCPTCRA 331
           +  S C IC E++ T++ +     CGHL H  C    L+  + CP C  
Sbjct: 3   SGSSGCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEGYRCPLCSG 51


>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
2ect_A78 Ring finger protein 126; metal binding protein, st 99.41
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.4
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.39
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.37
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.37
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.37
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.36
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.36
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.35
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.34
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.33
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.32
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.31
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.3
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.3
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.29
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.29
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.28
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.28
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.27
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.26
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.24
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.24
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.24
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.22
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.21
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.2
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.2
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.18
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.15
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.14
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.14
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.13
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.12
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.11
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.1
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.08
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.08
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.07
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.06
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.06
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.05
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.04
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.02
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.02
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.01
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.01
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.01
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.99
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.97
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.95
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.93
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.92
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.9
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.89
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.84
2ea5_A68 Cell growth regulator with ring finger domain prot 98.78
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.77
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.72
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.71
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.7
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.59
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.57
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.57
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.49
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.49
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.48
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.33
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.91
3nw0_A238 Non-structural maintenance of chromosomes element 97.68
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.53
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 94.3
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 93.57
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 92.42
1wil_A89 KIAA1045 protein; ring finger domain, structural g 91.64
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 87.92
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 86.78
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 82.55
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 82.4
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 81.91
2k16_A75 Transcription initiation factor TFIID subunit 3; p 81.5
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 81.05
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 80.51
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
Probab=99.41  E-value=1.5e-13  Score=104.88  Aligned_cols=56  Identities=32%  Similarity=0.848  Sum_probs=46.7

Q ss_pred             cCCCCccccccccccCC---eEEeecccccHhhHHHHHhcCCCCccccCcccCCCCCCC
Q 015350          286 DASDSTCIICREEMTTA---KKLICGHLFHVHCLRSWLERQHTCPTCRALVVPPENGAS  341 (408)
Q Consensus       286 ~~~~~~C~IC~~~~~~~---~~lpC~H~Fh~~Cl~~wl~~~~~CP~Cr~~i~~~~~~~~  341 (408)
                      ...+..|+||++.+..+   ..+||+|.||..|+.+|++++.+||+||+++........
T Consensus        12 ~~~~~~C~IC~~~~~~~~~~~~~~C~H~fc~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~   70 (78)
T 2ect_A           12 VGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNTATN   70 (78)
T ss_dssp             SSSSCCCTTTTSCCCTTSCEEECTTSCEEETTTTHHHHTTTCSCTTTCCCCCCSCSCCC
T ss_pred             CCCCCCCeeCCccccCCCCEEEeCCCCeecHHHHHHHHHcCCcCcCcCCccCCcccCCC
Confidence            34577999999999866   346999999999999999999999999999876544433



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 408
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 6e-15
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 6e-15
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 4e-14
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-13
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 7e-13
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 2e-10
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 3e-10
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-09
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 1e-09
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 6e-09
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 7e-09
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 1e-06
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 2e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-05
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 1e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 3e-04
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 5e-04
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 7e-04
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 9e-04
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 0.001
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 67.3 bits (164), Expect = 6e-15
 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 283 EELDASDSTCIICREEMTTAKKLICGHLFHVHCLRSWLERQH-TCPTCRALV 333
            E+ ++   C IC E     K   CGHL    CL SW E +   CP CR  +
Sbjct: 17  CEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEI 68


>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.44
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.43
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.39
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.28
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.28
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.27
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.25
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.24
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.24
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.21
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.17
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.06
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.05
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.99
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.97
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.81
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.04
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 92.3
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 89.54
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 89.27
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 88.19
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 84.18
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 82.9
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 80.99
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.44  E-value=1.3e-14  Score=101.33  Aligned_cols=47  Identities=40%  Similarity=0.951  Sum_probs=40.6

Q ss_pred             CCCccccccccccCC---eEE-eecccccHhhHHHHHhcCCCCccccCccc
Q 015350          288 SDSTCIICREEMTTA---KKL-ICGHLFHVHCLRSWLERQHTCPTCRALVV  334 (408)
Q Consensus       288 ~~~~C~IC~~~~~~~---~~l-pC~H~Fh~~Cl~~wl~~~~~CP~Cr~~i~  334 (408)
                      ++.+|+||++++.++   .++ +|||.||..|+.+|++++.+||+||+++.
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            456799999999764   344 59999999999999999999999999874



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure