Citrus Sinensis ID: 015364


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MRIAVEGCMHGELDNVYKTLQYMENINSYKIDLLLCCGDFQAVRNENDMESLNVPRKYREMKSFWKYYSGQEVAPIPTIFIGGNHEASNYLWELYYGGWAAPNIYFLGFAGVVKFGNIRIGGLSGIYNARHYRLGHYERPPYNESTIRSVYHVREYDVHKLMQIEEPIDIFLSHDWPCGITDYGNCKELVRHKQYFEKEIQDGTLGSEPAAQLLEKLKPSYWFSAHLHCKFAAVVQHGEDSPVTKFLALDKCLPRRKFLQVFEIESGQGPYEIQYDEEWLAITRTFNSVFPLTSQSANFGGVQHDMNDCRQWVRSRLQERGAKPFEFVRTVPCYDASQSLSIGAFAENPQNPQTESFLQFLELPNLFENALESREPTQSPATLDHKGPDLDPEEIPIDDEDELEELDE
cEEEEECcccccHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccHHHHHcccccccccccccccEEEEEEccccccHHHHHHHccccCECccEEEEccccEEEEccEEEEEEEEEECccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEccccccccccccHHHHHHHccccHHcccccccccHHHHHHHHHHcccEEEEccccccccEECcccccccccEEEcccccccccccEEEEEcccccccccccccHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHcccc
MRIAVEGCMHGELDNVYKTLQYMENINSYKIDLLLCCGDFQAVRNENDMESLNVPRKYREMKSFWKYYSGQEVAPIPTIFIGGNHEASNYLWELYYGGWAAPNIYFLGFAGVVKFGNIRIGGLSGIYNARHYRLGHYERPPYNESTIRSVYHVREYDVHKLMQIEEPIDIFLSHDWPCGITDYGNCKELVRHKQYFEKEIQDGTLGSEPAAQLLEKLKPSYWFSAHLHCKFAAVVQHGEDSPVTKFLALDKCLPRRKFLQVFEIESGQGPYEIQYDEEWLAITRTFNSVFPLTSQSANFGGVQHDMNDCRQWVRSRLQERGAKPFEFVRTVPCYDASQSLSIGAF**NPQNPQTESFLQFLELPNLF*****************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIAVEGCMHGELDNVYKTLQYMENINSYKIDLLLCCGDFQAVRNENDMESLNVPRKYREMKSFWKYYSGQEVAPIPTIFIGGNHEASNYLWELYYGGWAAPNIYFLGFAGVVKFGNIRIGGLSGIYNARHYRLGHYERPPYNESTIRSVYHVREYDVHKLMQIEEPIDIFLSHDWPCGITDYGNCKELVRHKQYFEKEIQDGTLGSEPAAQLLEKLKPSYWFSAHLHCKFAAVVQHGEDSPVTKFLALDKCLPRRKFLQVFEIESGQGPYEIQYDEEWLAITRTFNSVFPLTSQSANFGGVQHDMNDCRQWVRSRLQERGAKPFEFVRTVPCYDASQSLSIGAFAENPQNPQTESFLQFLELPNLFENALESREPTQSPATLDHKGPDLDPEEIPIDDEDELEELDE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lariat debranching enzyme Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover. It may also participate in retrovirus replication via a RNA lariat intermediate in cDNA synthesis. Plays en essential role during embryogenesis.confidentQ94K01
Lariat debranching enzyme Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover. It may also participate in retrovirus replication via a RNA lariat intermediate in cDNA synthesis.confidentQ6AU07
Lariat debranching enzyme Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover. It may also participate in retrovirus replication via a RNA lariat intermediate in cDNA synthesis.probableQ7T3E4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YVT, chain A
Confidence level:confident
Coverage over the Query: 1-130,141-265
View the alignment between query and template
View the model in PyMOL
Template: 2XMO, chain A
Confidence level:confident
Coverage over the Query: 1-186,201-267
View the alignment between query and template
View the model in PyMOL