Citrus Sinensis ID: 015376


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MSQAVHLTAKSPPGYGPSEGRCLPCMGVSGRAVAVSSCSSRGDFRILSQVKIGAVKYSSKGASFACRASSGSYRRNPDFSRQNRNGYRGRNRQNEERDSIDDESELLSSRNGPILSLSNSPKFQATSTPGPREKEIVELFRKVQVQLRERAAAREDKKTESMQGQRKESETVDSLLKLLRKHSVEQGKRKSSSGSSNDFSLEQDEPNGSHIEDKSTSFFDSSSRARTESREPNVSSFTRPASNFRRRSPVTQFKYQPVYSSEETENSISRLDSSGKGKKSSLEIHTDPKRESESEPELETEPEASFADGEVYDEASDVESNVITDGSLYDEVLENEPNIIDDSVYRVSEEGESSDNDEDENKQEEIENGDLSALKLPELRALAKSRGVKGFSKMKKAVLLELLAGSSV
cccccccccccccccccccccccccccccccEEcccccccccccccccEEEEccEEEcccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccHHHHHHHHHHccccccccccHHHHHHHHHcccc
******L*AKSPPGYGPSEGRCLPCMGVSGRAVAVSSCSSRGDFRILSQVKIGAVKYSSKGASF**************************************************************************LF*********************************************************************************************************************************************************************************************************************************************ELRALAKSRGVKGFSKMKKAVLLELLAG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQAVHLTAKSPPGYGPSEGRCLPCMGVSGRAVAVSSCSSRGDFRILSQVKIGAVKYSSKGASFACRASSGSYRRNPDFSRQNRNGYRGRNRQNEERDSIDDESELLSSRNGPILSLSNSPKFQATSTPGPREKEIVELFRKVQVQLRERAAAREDKKTESMQGQRKESETVDSLLKLLRKHSVEQGKRKSSSGSSNDFSLEQDEPNGSHIEDKSTSFFDSSSRARTESREPNVSSFTRPASNFRRRSPVTQFKYQPVYSSEETENSISRLDSSGKGKKSSLEIHTDPKRESESEPELETEPEASFADGEVYDEASDVESNVITDGSLYDEVLENEPNIIDDSVYRVSEEGESSDNDEDENKQEEIENGDLSALKLPELRALAKSRGVKGFSKMKKAVLLELLAGSSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rho-N domain-containing protein 1, chloroplastic Binds to and supports processing of specific plastid RNAs. Associates via its C-terminal Rho-N domain to single stranded regions of 16S and 23S rRNAs or to rbcL mRNAs. May be involved in targeting transcripts to RNases such as RNE or RNase J.probableQ94K75
SAP-like protein BP-73 May regulate cell proliferation and plant growth.probableQ8L4E7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OUT, chain A
Confidence level:probable
Coverage over the Query: 368-406
View the alignment between query and template
View the model in PyMOL