Citrus Sinensis ID: 015387


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MGGLKENINACLIEGASNFQDDVRLGGSKQTMELVQNPRRALSVINQNIWGATIRSNAINKKGLGNGVAHKPNPGLAEAVIGDVEETRDDHTVIDVEDCGDDDGAAVPMFVRHTEAFLDEIDRMDVDELEVTEDPILDIDGRDLKNPLAVVEYVDDIYAYYRKIEISSCVSPTYMDHQSDINEKMRAILIDWLLEVHYKFELMDETLFLTINIVDKFLERQVVVRKKLQLVGVTAMLLACKYEEVSVPIVDDFILISDNAYTRKEVLDMEKLLLNTLQFNMSVPTPYVFMRRFLKAAQSDKKLELLAFFIVELCLVEYKMLKFPPSLLAAAAIYTAQCSLYQLKQWTKTSEWLTNYPEDQLLECSRLMVTLHEKAATGKLTGVYRKFNTSKFGHAAKAEPALFLLNNQ
ccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccHHHcHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccc
*************************************************W***********************************************************************************DPILDIDGRDLKNPLAVVEYVDDIYAYYRKIEISSCVSPTYMDHQSDINEKMRAILIDWLLEVHYKFELMDETLFLTINIVDKFLERQVVVRKKLQLVGVTAMLLACKYEEVSVPIVDDFILISDNAYTRKEVLDMEKLLLNTLQFNMSVPTPYVFMRRFLKAAQSDKKLELLAFFIVELCLVEYKMLKFPPSLLAAAAIYTAQCSLYQLKQWTKTSEWLTNYPEDQLLECSRLMVTLHEKAATGKLTGVYRKFNTSKFGHAAKAEPALFLL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGLKENINACLIEGASNFQDDVRLGGSKQTMELVQNPRRALSVINQNIWGATIRSNAINKKGLGNGVAHKPNPGLAEAVIGDVEETRDDHTVIDVEDCGDDDGAAVPMFVRHTEAFLDEIDRMDVDELEVTEDPILDIDGRDLKNPLAVVEYVDDIYAYYRKIEISSCVSPTYMDHQSDINEKMRAILIDWLLEVHYKFELMDETLFLTINIVDKFLERQVVVRKKLQLVGVTAMLLACKYEEVSVPIVDDFILISDNAYTRKEVLDMEKLLLNTLQFNMSVPTPYVFMRRFLKAAQSDKKLELLAFFIVELCLVEYKMLKFPPSLLAAAAIYTAQCSLYQLKQWTKTSEWLTNYPEDQLLECSRLMVTLHEKAATGKLTGVYRKFNTSKFGHAAKAEPALFLLNNQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclin-B2-3 probableQ9LDM4
Cyclin-B2-2 Involved in the control of the cell cycle at the G2/M (mitosis) transition. May associate to CDKB2-1 and activate CDKB2-1 kinase activity to promote cell division.probableQ0D9C7
Cyclin-B2-2 Involved in the control of the cell cycle at the G2/M (mitosis) transition. May associate to CDKB2-1 and activate CDKB2-1 kinase to promote cell division.probableA2YH60

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2B9R, chain A
Confidence level:very confident
Coverage over the Query: 154-404
View the alignment between query and template
View the model in PyMOL