Citrus Sinensis ID: 015434


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------
MQSAAAFTAAPNLPLLKPRRLSANHGPCHVVLCSKRHDSNVVPPSPSAFPPIRRSWSLSSTPSSMFRPWTAVPLRDPDTTGRSQATAVPESAGGEEHQTTELSRKIEVLLLMGLWYFFNIIFNIYNKQVLKVYRFPVTVTTCQFGVGTVLVLLLWTFNLYRPKVSSTQLAAILPLALVHTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGEFPTLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLNLKEVYVRSLIAAICYHAYQQVSYMILQRVSPVTHSVGNCVKRVVVIVSSVMFFRTPVSAINAFGTGIALAGVFLYSRVKRIKPKAKTA
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccccc
*******************************************************************************************************RKIEVLLLMGLWYFFNIIFNIYNKQVLKVYRFPVTVTTCQFGVGTVLVLLLWTFNLYRPKVSSTQLAAILPLALVHTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGEFPTLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLNLKEVYVRSLIAAICYHAYQQVSYMILQRVSPVTHSVGNCVKRVVVIVSSVMFFRTPVSAINAFGTGIALAGVFLYSRVKR********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSAAAFTAAPNLPLLKPRRLSANHGPCHVVLCSKRHDSNVVPPSPSAFPPIRRSWSLSSTPSSMFRPWTAVPLRDPDTTGRSQATAVPESAGGEEHQTTELSRKIEVLLLMGLWYFFNIIFNIYNKQVLKVYRFPVTVTTCQFGVGTVLVLLLWTFNLYRPKVSSTQLAAILPLALVHTLGNLFTNMSLGKVAVSFTHTIKATEPFFSVLLSAMFLGEFPTLWVVGSLIPIMGGVALASVTEVSFNWAGFWSAMASNLTNQSRNVLSKKVMVNKEEALDNITLFSIITVMSFILMIPVTLIMEGVTFTPAYLQSAGLNLKEVYVRSLIAAICYHAYQQVSYMILQRVSPVTHSVGNCVKRVVVIVSSVMFFRTPVSAINAFGTGIALAGVFLYSRVKRIKPKAKTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphoenolpyruvate/phosphate translocator 1, chloroplastic Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP), 2-phosphoglycerate, 3-phosphoglycerate and dihydroxyacetone phosphate. Imports PEP to the chloroplast stroma as one substrate of the shikimate pathway, from which aromatic amino acids and a variety of secondary products derive. Required for correct leaf mesophyll cell development and expression of chlorophyll a/b binding protein 3 (CAB3).probableQ8RXN3
Phosphoenolpyruvate/phosphate translocator 2, chloroplastic Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate.probableQ84QU8
Triose phosphate/phosphate translocator, non-green plastid, chloroplastic Mediates the export of fixed carbons from the chloroplasts into the cytosol in the form of triose phosphates.probableP52178

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 173-242
View the alignment between query and template
View the model in PyMOL
Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 327-397
View the alignment between query and template
View the model in PyMOL