Citrus Sinensis ID: 015502

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-----

MDGETSWINHCIDDMARGINEFDSFLELSDEGNKEASTLSVDLILPDDLLERILAYLPIASIFRAGCVCRRWHEIVSSRRFLWNFSNVLSQKPWYFMFTSSDEPIGYAYDPILRKWYGIELPCIETSNWFIASSYGLVCFMDNDSRSELYVCNPISKSWKKLEEPPGLKFSDYSALSLSVDRVSHRYTVSIVKSKQVTGNFFQWELSIHIYDSDTMMWVTSWKEVLTGWRAGDESIICDGVLYFLIYATGGGAPENRHGLISFNLSSRSSHALLIKSFIPVPCALTCGRLMNLKEKLVMVGGIGKQDRPDIIKGIGIWVLNGKEWQEVARMPHKFFQGFGEFDDVFASSGTDDLIYIQSYGAPSLLVYDMNLKQWRWSHKCPVTKRFPLQLFTGFCFEPRLEIAP

ccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHccccHHHHHHHccHHHHHHHHcccccccEEEEEEccccccCEEEccccccCECccccccccccEEEEEEccEEEEEEcccccEEEEEccccccEECccccccccccccEEEEEEEEcccccEEEEEEEEEccccccEEEEEEEEEECcccccEEEccccccccccccccEEEEccEEEEEEEEcccccccccCEEEEEEcccccEEEEEccccccccccccccCEEEEccEEEEEEccccccccccCEEEEEEEEEcccEEEEEEEcHHHHcccccccccEEEEccccEEEEEEccccEEEEEEccccEEEECccccccccccccEEEEEEEECcccccc

******WINH**DDMARGIN*****************TLSVDLILPDDLLERILAYLPIASIFRAGCVCRRWHEIVSSRRFLWNFSNVLSQKPWYFMFTSSDEPIGYAYDPILRKWYGIELPCIETSNWFIASSYGLVCFMDNDSRSELYVCNPISKSWKKLEEPPGLKFSDYSALSLSVDRVSHRYTVSIVKSKQVTGNFFQWELSIHIYDSDTMMWVTSWKEVLTGWRAGDESIICDGVLYFLIYATGGGAPENRHGLISFNLSSRSSHALLIKSFIPVPCALTCGRLMNLKEKLVMVGGIGKQDRPDIIKGIGIWVLNGKEWQEVARMPHKFFQGFGEFDDVFASSGTDDLIYIQSYGAPSLLVYDMNLKQWRWSHKCPVTKRFPLQLFTGFCFEPRLEIA*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
F-box/kelch-repeat protein At3g61590	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	probable	Q9M310

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FS1, chain A
Confidence level:confident
Coverage over the Query: 42-82
View the alignment between query and template
View the model in PyMOL

Template: 2UVK, chain A
Confidence level:confident
Coverage over the Query: 93-379
View the alignment between query and template
View the model in PyMOL

Template: 4G56, chain B
Confidence level:probable
Coverage over the Query: 133-399
View the alignment between query and template
View the model in PyMOL