Citrus Sinensis ID: 015596


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400----
MLPRSRTMPSRIHHGAVEERHDVRHYLQVEVQPKAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWVAGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYLNLFVTGTQKLWRSLQALGAIAFAYSFSIILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAAFGDLAPNNLLTGFGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPFWGVYQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQKKIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY
cccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccCEEEEEcEEEccccccccHHHHHHHHHHHHHHHHHccccEEEEEHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
*************HGAVEERHDVRHYLQVEVQPK************NYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWVAGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYLNLFVTGTQKLWRSLQALGAIAFAYSFSIILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAAFGDLAPNNLLTGFGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPFWGVYQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQKKIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPRSRTMPSRIHHGAVEERHDVRHYLQVEVQPKAHIETEATNPQANYSNCFDDDGRLKRTGNFWTTSSHIITAVIGSGVLSLAWAIAQLGWVAGPTVLILFALVNLYTANLLSQCYRSGDPVTGQRNYTYMDAVKANLGGKKVIFCGLIQYLNLFVTGTQKLWRSLQALGAIAFAYSFSIILLEIQDTIRSPPAEYKTMKKATLFSIIVTTTFYLLCGCMGYAAFGDLAPNNLLTGFGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPFWGVYQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQKKIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Amino acid permease 4 Amino acid-proton symporter. Stereospecific transporter with a broad specificity for neutral amino acids, favoring small amino acids such as alanine, asparagine and glutamine. Accepts also large aromatic residues such as in phenlalanine or tyrosine.probableQ9FN04

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 59-360
View the alignment between query and template
View the model in PyMOL