Citrus Sinensis ID: 015659
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 403 | ||||||
| 255538020 | 598 | peptidylprolyl isomerase, putative [Rici | 0.791 | 0.533 | 0.514 | 3e-88 | |
| 224067192 | 573 | predicted protein [Populus trichocarpa] | 0.791 | 0.556 | 0.511 | 1e-85 | |
| 356552270 | 582 | PREDICTED: 70 kDa peptidyl-prolyl isomer | 0.791 | 0.548 | 0.485 | 2e-78 | |
| 356564113 | 583 | PREDICTED: 70 kDa peptidyl-prolyl isomer | 0.791 | 0.547 | 0.474 | 4e-77 | |
| 357437549 | 609 | 70 kDa peptidyl-prolyl isomerase [Medica | 0.784 | 0.518 | 0.467 | 4e-77 | |
| 225458880 | 600 | PREDICTED: 70 kDa peptidyl-prolyl isomer | 0.791 | 0.531 | 0.460 | 1e-76 | |
| 297840663 | 584 | hypothetical protein ARALYDRAFT_338459 [ | 0.789 | 0.544 | 0.474 | 2e-75 | |
| 414869595 | 559 | TPA: hypothetical protein ZEAMMB73_59337 | 0.789 | 0.568 | 0.427 | 2e-68 | |
| 255589766 | 574 | peptidylprolyl isomerase, putative [Rici | 0.786 | 0.552 | 0.431 | 3e-68 | |
| 226500876 | 553 | LOC100283417 [Zea mays] gi|195634685|gb| | 0.784 | 0.571 | 0.429 | 3e-68 |
| >gi|255538020|ref|XP_002510075.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223550776|gb|EEF52262.1| peptidylprolyl isomerase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 332 bits (850), Expect = 3e-88, Method: Compositional matrix adjust.
Identities = 183/356 (51%), Positives = 236/356 (66%), Gaps = 37/356 (10%)
Query: 45 NSGIKKKLLKNGVDWDTPEFGDEVTIHYVGTLLDGTKFDSTRDRYDPLTFKLGTGQVATG 104
+ GI K++++ + P DEV + Y L DGT T + + + F + G +
Sbjct: 153 DGGIVKRIIEKPEKIERPGDLDEVLVKYEVKLADGTIVAKTPE--EGIEFHVKDGHLCPA 210
Query: 105 LDNGIITMKKRECAVFTFTLPSELRFGVEGRDS------LPPNSVVQFEVELVSWITVVD 158
L ++TM+ E + + FG EG+D+ +PPNSV+ ++EL+S+ VVD
Sbjct: 211 LPKAVMTMRGGEKV--KLIVHPQYAFGEEGKDANDGILPVPPNSVLNMDLELISFKPVVD 268
Query: 159 LSKDGGIVKKILEKGERDASPGDLDEVLVKYQVMLGDGTMVAKTPEEGVEFYLKDVSYIA 218
++ D + KKIL++GE GT VA E L +SY A
Sbjct: 269 VTGDTKVFKKILKEGE---------------------GTNVAN------EGALVTISYTA 301
Query: 219 RLEDGTVFEKKGYDGEQPLEFITDEEQVIAGLDRVAATMKKEEWAIVTINHEYGFGNVEA 278
RL+DGT+FEK+G DGEQPL+F+TDEEQVIAGLDR AATMKK E A++TIN EYGFG+VE
Sbjct: 302 RLQDGTIFEKRGLDGEQPLQFVTDEEQVIAGLDRAAATMKKGERAVLTINPEYGFGSVEV 361
Query: 279 KRDLATIPSCAKLYYEVEMMDFIKEKVPWEMNNQGKIEAAGRKKEEGNLLFKNGKYERAG 338
K+D ATIP + L YE+EM+DFIKEK PWEMNN+ KIEAAGRKKEEGNLLFK+GK++RAG
Sbjct: 362 KQDHATIPPSSVLVYEIEMLDFIKEKTPWEMNNKEKIEAAGRKKEEGNLLFKSGKFQRAG 421
Query: 339 KKYNKAADCVSEDGSFVDDEQKLVKSLRVSCWLNSAACCLKLKDYQGAIELCSKVI 394
KKY+KAAD + E+ SF DDEQKL+KSLRVSCWLN AAC LKL D+QG I LCSKV+
Sbjct: 422 KKYDKAADYIVEEVSFDDDEQKLIKSLRVSCWLNGAACSLKLGDFQGTINLCSKVL 477
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224067192|ref|XP_002302401.1| predicted protein [Populus trichocarpa] gi|222844127|gb|EEE81674.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356552270|ref|XP_003544491.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356564113|ref|XP_003550301.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357437549|ref|XP_003589050.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula] gi|355478098|gb|AES59301.1| 70 kDa peptidyl-prolyl isomerase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225458880|ref|XP_002283423.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase [Vitis vinifera] gi|302142176|emb|CBI19379.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297840663|ref|XP_002888213.1| hypothetical protein ARALYDRAFT_338459 [Arabidopsis lyrata subsp. lyrata] gi|297334054|gb|EFH64472.1| hypothetical protein ARALYDRAFT_338459 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|414869595|tpg|DAA48152.1| TPA: hypothetical protein ZEAMMB73_593378 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|255589766|ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223524081|gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|226500876|ref|NP_001149790.1| LOC100283417 [Zea mays] gi|195634685|gb|ACG36811.1| peptidyl-prolyl isomerase [Zea mays] gi|414869593|tpg|DAA48150.1| TPA: peptidyl-prolyl isomerase [Zea mays] gi|414869594|tpg|DAA48151.1| TPA: peptidyl-prolyl isomerase [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 403 | ||||||
| UNIPROTKB|Q6K5Q1 | 682 | P0579G08.8 "Putative peptidylp | 0.481 | 0.284 | 0.517 | 1.4e-99 | |
| UNIPROTKB|Q9XFE4 | 585 | OSJNBa0091C07.4 "OSJNBa0091C07 | 0.516 | 0.355 | 0.504 | 1.9e-51 | |
| UNIPROTKB|Q7F1F2 | 580 | OJ1191_A10.119 "cDNA clone:J03 | 0.516 | 0.358 | 0.506 | 8.3e-51 | |
| TAIR|locus:2152561 | 578 | ROF2 "AT5G48570" [Arabidopsis | 0.486 | 0.339 | 0.522 | 1.8e-48 | |
| TAIR|locus:2090265 | 562 | ROF1 "AT3G25230" [Arabidopsis | 0.481 | 0.345 | 0.54 | 4.7e-48 | |
| UNIPROTKB|A8J0I6 | 569 | FKB62 "Peptidyl-prolyl cis-tra | 0.471 | 0.333 | 0.376 | 4.7e-47 | |
| UNIPROTKB|F1NIM4 | 442 | FKBP4 "Uncharacterized protein | 0.486 | 0.443 | 0.333 | 3.2e-46 | |
| UNIPROTKB|F1NP08 | 464 | FKBP4 "Uncharacterized protein | 0.486 | 0.422 | 0.333 | 5.5e-46 | |
| ZFIN|ZDB-GENE-030131-514 | 450 | fkbp4 "FK506 binding protein 4 | 0.332 | 0.297 | 0.4 | 1.3e-42 | |
| UNIPROTKB|P27124 | 458 | FKBP4 "Peptidyl-prolyl cis-tra | 0.434 | 0.382 | 0.342 | 2.2e-42 |
| UNIPROTKB|Q6K5Q1 P0579G08.8 "Putative peptidylprolyl isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Score = 511 (184.9 bits), Expect = 1.4e-99, Sum P(2) = 1.4e-99
Identities = 103/199 (51%), Positives = 138/199 (69%)
Query: 32 AAPLKVGEERGLGNSGIKKKLLKNGVDWDTPEFGDEVTIHYVGTLLDGTKFDSTRDRYDP 91
AA ++VGEE+ +G G++KKL+K G W+ P+ GDEV +HY GTLLDGTKFDS+RDR P
Sbjct: 80 AAEMEVGEEKEIGKEGLRKKLVKEGEGWERPDAGDEVQVHYTGTLLDGTKFDSSRDRDAP 139
Query: 92 LTFKLGTGQVATGLDNGIITMKKRECAVFTFTLPSELRFGVEGRDS-LPPNSVVQFEVEL 150
F LG GQV G D GI TMKK E A+FT +P EL +G +G +PPN+ +QF+VEL
Sbjct: 140 FKFTLGQGQVIKGWDLGIKTMKKGENAIFT--IPPELAYGEDGSPPVIPPNATLQFDVEL 197
Query: 151 VSWITVVDLSKDGGIVKKILEKGERDASPGDLDEVLVKYQVMLGDGTMVAKTPEEGVEFY 210
+SW +V D+ KDGGI+KK+L +G + +P D DEV VKY+V L DGT+VA++ +GVEF
Sbjct: 198 ISWESVKDICKDGGILKKVLAEGTKWENPRDRDEVFVKYEVRLEDGTVVAES--DGVEFT 255
Query: 211 LKDVSYIARLEDGTVFEKK 229
+KD + + KK
Sbjct: 256 VKDGHFCPAISKAVKTMKK 274
|
|
| UNIPROTKB|Q9XFE4 OSJNBa0091C07.4 "OSJNBa0091C07.4 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7F1F2 OJ1191_A10.119 "cDNA clone:J033121G16, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090265 ROF1 "AT3G25230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8J0I6 FKB62 "Peptidyl-prolyl cis-trans isomerase, FKBP-type" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NIM4 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NP08 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-514 fkbp4 "FK506 binding protein 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P27124 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4" [Oryctolagus cuniculus (taxid:9986)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.II.4140.1 | hypothetical protein (538 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 403 | |||
| pfam00254 | 94 | pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t | 7e-26 | |
| COG0545 | 205 | COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans | 1e-20 | |
| pfam00254 | 94 | pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t | 2e-13 | |
| PRK10902 | 269 | PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- | 5e-10 | |
| COG1047 | 174 | COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans | 6e-09 | |
| PRK11570 | 206 | PRK11570, PRK11570, peptidyl-prolyl cis-trans isom | 8e-08 | |
| COG0545 | 205 | COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans | 4e-07 | |
| TIGR03516 | 177 | TIGR03516, ppisom_GldI, peptidyl-prolyl isomerase, | 5e-07 | |
| PRK15095 | 156 | PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis- | 6e-06 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 8e-06 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 2e-05 | |
| COG1047 | 174 | COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans | 3e-04 |
| >gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase | Back alignment and domain information |
|---|
Score = 99.6 bits (249), Expect = 7e-26
Identities = 44/95 (46%), Positives = 58/95 (61%), Gaps = 4/95 (4%)
Query: 59 WDTPEFGDEVTIHYVGTLLDGTKFDSTRDRYDPLTFKLGTGQVATGLDNGIITMKKRECA 118
+ + GD VT+HY G L DGT FDS++DR P F LG+GQV G D G++ MK E
Sbjct: 2 PEKAKKGDTVTVHYTGKLEDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMKVGE-- 59
Query: 119 VFTFTLPSELRFGVEGR--DSLPPNSVVQFEVELV 151
T+P EL +G EG +PPN+ + FEVEL+
Sbjct: 60 KRKLTIPPELAYGEEGLAGGVIPPNATLVFEVELL 94
|
Length = 94 |
| >gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|132555 TIGR03516, ppisom_GldI, peptidyl-prolyl isomerase, gliding motility-associated | Back alignment and domain information |
|---|
| >gnl|CDD|237908 PRK15095, PRK15095, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223976 COG1047, SlpA, FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 403 | |||
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 100.0 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.97 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 99.95 | |
| COG0545 | 205 | FkpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.94 | |
| KOG0544 | 108 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.94 | |
| KOG0544 | 108 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.93 | |
| COG0545 | 205 | FkpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.9 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.89 | |
| PRK11570 | 206 | peptidyl-prolyl cis-trans isomerase; Provisional | 99.89 | |
| KOG0552 | 226 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.87 | |
| TIGR03516 | 177 | ppisom_GldI peptidyl-prolyl isomerase, gliding mot | 99.86 | |
| PRK10902 | 269 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.85 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.85 | |
| PRK11570 | 206 | peptidyl-prolyl cis-trans isomerase; Provisional | 99.79 | |
| PF00254 | 94 | FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer | 99.78 | |
| TIGR03516 | 177 | ppisom_GldI peptidyl-prolyl isomerase, gliding mot | 99.75 | |
| PRK15095 | 156 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.75 | |
| KOG0552 | 226 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.74 | |
| COG1047 | 174 | SlpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.74 | |
| PF00254 | 94 | FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer | 99.72 | |
| PRK10902 | 269 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.71 | |
| PRK10737 | 196 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.69 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.52 | |
| PRK15095 | 156 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.46 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.3 | |
| COG1047 | 174 | SlpA FKBP-type peptidyl-prolyl cis-trans isomerase | 99.28 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.28 | |
| PRK10737 | 196 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 99.23 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 99.2 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.03 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.02 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.02 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 99.01 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 98.94 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.68 | |
| COG0544 | 441 | Tig FKBP-type peptidyl-prolyl cis-trans isomerase | 98.65 | |
| TIGR00115 | 408 | tig trigger factor. Trigger factor is a ribosome-a | 98.56 | |
| PRK01490 | 435 | tig trigger factor; Provisional | 98.54 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.46 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.32 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.32 | |
| TIGR00115 | 408 | tig trigger factor. Trigger factor is a ribosome-a | 98.23 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.23 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 98.2 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.12 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.07 | |
| PRK01490 | 435 | tig trigger factor; Provisional | 98.07 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.06 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.02 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 97.99 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 97.98 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 97.89 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 97.88 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.83 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 97.77 | |
| COG0544 | 441 | Tig FKBP-type peptidyl-prolyl cis-trans isomerase | 97.72 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.7 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.66 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 97.6 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 97.58 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.52 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.51 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 97.47 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 97.36 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 97.34 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 97.32 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.28 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 97.27 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.27 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 97.27 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 97.25 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 97.23 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 97.23 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.19 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 97.17 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.1 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 97.09 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.05 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.03 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.03 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.0 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 96.94 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 96.94 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 96.91 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 96.84 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 96.8 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 96.8 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 96.79 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 96.79 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 96.77 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.77 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 96.76 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 96.75 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.74 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 96.73 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 96.7 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 96.68 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 96.66 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 96.57 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 96.53 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 96.53 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.41 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 96.35 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 96.33 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 96.33 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.26 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 96.22 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 96.2 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 96.19 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 96.19 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.19 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 96.13 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 96.03 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 96.02 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 96.0 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 95.94 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 95.82 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 95.8 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 95.73 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 95.61 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 95.59 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 95.48 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 95.45 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 95.41 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 95.36 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 95.35 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 95.32 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 95.3 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 95.3 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 95.25 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 95.19 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 95.16 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 95.05 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 95.02 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 94.97 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 94.94 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 94.92 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 94.88 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 94.86 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 94.73 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 94.66 | |
| PLN02789 | 320 | farnesyltranstransferase | 94.58 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 94.54 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 94.51 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 94.49 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 94.45 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 94.4 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 94.38 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 94.3 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 94.26 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 94.22 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 94.03 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 94.01 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 93.98 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 93.87 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 93.81 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 93.73 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 93.71 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 93.57 | |
| PF10952 | 140 | DUF2753: Protein of unknown function (DUF2753); In | 93.51 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 93.42 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 93.41 | |
| PLN02789 | 320 | farnesyltranstransferase | 93.3 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 93.17 | |
| cd02677 | 75 | MIT_SNX15 MIT: domain contained within Microtubule | 93.12 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 93.09 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 93.07 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 93.01 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 92.8 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 92.74 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 92.63 | |
| cd02683 | 77 | MIT_1 MIT: domain contained within Microtubule Int | 92.61 | |
| cd02684 | 75 | MIT_2 MIT: domain contained within Microtubule Int | 92.57 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 92.42 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 92.38 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 92.36 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 92.24 | |
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 92.2 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 91.68 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 91.66 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 91.59 | |
| PF06957 | 422 | COPI_C: Coatomer (COPI) alpha subunit C-terminus; | 91.56 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 90.94 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 90.78 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 90.62 | |
| cd02678 | 75 | MIT_VPS4 MIT: domain contained within Microtubule | 90.34 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 90.21 | |
| cd02656 | 75 | MIT MIT: domain contained within Microtubule Inter | 90.13 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 89.87 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 89.64 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 89.11 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 89.1 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 88.87 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 88.75 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 88.7 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 88.3 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 88.22 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 88.21 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 87.91 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 87.7 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 87.28 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 87.14 | |
| PF00244 | 236 | 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 | 86.9 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 86.81 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 86.72 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 86.69 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 86.59 | |
| smart00745 | 77 | MIT Microtubule Interacting and Trafficking molecu | 86.41 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 85.85 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 85.62 | |
| cd02680 | 75 | MIT_calpain7_2 MIT: domain contained within Microt | 85.61 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 85.49 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 85.08 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 85.07 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 84.96 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 84.78 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 84.69 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 84.58 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 84.42 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 83.97 | |
| cd02679 | 79 | MIT_spastin MIT: domain contained within Microtubu | 83.85 | |
| KOG0686 | 466 | consensus COP9 signalosome, subunit CSN1 [Posttran | 83.47 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 83.23 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 83.2 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 82.97 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 82.87 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 82.56 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 82.35 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 82.19 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 81.99 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 81.79 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 81.64 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 81.56 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 80.96 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 80.8 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 80.66 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 80.3 |
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-53 Score=401.73 Aligned_cols=288 Identities=46% Similarity=0.738 Sum_probs=263.9
Q ss_pred EccCCCCCCCCCCEEEEEEEEEEcCCcEEeccCCCCCCeeEEeCCCccchhHHHhhcCcccCcEEEEEEEcCCCCCCCCC
Q 015659 54 KNGVDWDTPEFGDEVTIHYVGTLLDGTKFDSTRDRYDPLTFKLGTGQVATGLDNGIITMKKRECAVFTFTLPSELRFGVE 133 (403)
Q Consensus 54 ~~G~G~~~~~~gd~V~v~y~~~~~~g~~~~ss~~~~~p~~~~lG~~~~~~gl~~al~~m~~Ge~~~v~~~vp~~~ayg~~ 133 (403)
++|+|+++|..||.|.+||++++.||+.|+||.+ +.|+.|.+|.+.++.+|+.++..|+.| +.
T Consensus 1 ~eg~g~~~p~~g~~v~~hytg~l~dgt~fdss~d-~~~~~~~lg~g~vi~~~~~gv~tm~~g----------------~~ 63 (397)
T KOG0543|consen 1 KEGTGTETPMTGDKVEVHYTGTLLDGTKFDSSRD-GDPFKFDLGKGSVIKGWDLGVATMKKG----------------EA 63 (397)
T ss_pred CCCCCccCCCCCceeEEEEeEEecCCeecccccC-CCceeeecCCCcccccccccccccccc----------------cc
Confidence 4789999999999999999999999999999998 799999999999999999999999973 44
Q ss_pred CCC-CCCCCCeEEEEEEeccceeeeccCCCcceeeEEeecCCc-CCCCCCCCceEEEEEeeeCCCceeecCCCCceeEEe
Q 015659 134 GRD-SLPPNSVVQFEVELVSWITVVDLSKDGGIVKKILEKGER-DASPGDLDEVLVKYQVMLGDGTMVAKTPEEGVEFYL 211 (403)
Q Consensus 134 ~~~-~ip~~~~l~~~v~l~~~~~~~dv~~d~~v~k~il~~G~g-~~~p~~~~~V~i~y~~~l~~~~~v~~~~~~g~~~~~ 211 (403)
+.+ .+|+++++.|+|+|+ |++++|+|+++|.+ ..+|..+..|.+||...+.
T Consensus 64 ~~pp~ip~~a~l~fe~el~----------Dg~iiKriir~G~gd~~~P~~g~~V~v~~~G~~~----------------- 116 (397)
T KOG0543|consen 64 GSPPKIPSNATLLFEVELL----------DGGIIKRIIREGEGDYSRPNKGAVVKVHLEGELE----------------- 116 (397)
T ss_pred CCCCCCCCCcceeeeeccc----------CCceEEeeeecCCCCCCCCCCCcEEEEEEEEEEC-----------------
Confidence 444 799999999999998 88999999999999 7899998888877655554
Q ss_pred eceEEEEeeccceEEeecCCCCCCCeEEEcCC-CCcchHHHHHHcccCCCcEEEEEEcCCCCCCCcccccCCCCCCCCCe
Q 015659 212 KDVSYIARLEDGTVFEKKGYDGEQPLEFITDE-EQVIAGLDRVAATMKKEEWAIVTINHEYGFGNVEAKRDLATIPSCAK 290 (403)
Q Consensus 212 ~~v~y~g~~~~g~~fd~s~~~~~~p~~~~lG~-~~v~~gl~~~l~~m~~Ge~~~v~i~~~~~yg~~~~~~~~~~ip~~~~ 290 (403)
++ +|+++ ...+.|.+|+ ..+|.||+.||++|++||++.|+|+|+|+||+.+.+ ++.|||+++
T Consensus 117 ----------~~-~f~~~----~~~fe~~~Ge~~~vi~Gle~al~~M~~GE~a~v~i~~~YayG~~~~~--~p~IPPnA~ 179 (397)
T KOG0543|consen 117 ----------DG-VFDQR----ELRFEFGEGEDIDVIEGLEIALRMMKVGEVALVTIDPKYAYGEEGGE--PPLIPPNAT 179 (397)
T ss_pred ----------Cc-ceecc----ccceEEecCCccchhHHHHHHHHhcCccceEEEEeCcccccCCCCCC--CCCCCCCce
Confidence 44 56555 3458888888 589999999999999999999999999999965542 689999999
Q ss_pred EEEEEEEeeec-cCcCccccCchHHHHHHHHHHHHhhHhhhcCcHHHHHHHHHHHHHHhccCCCCChHHHHHHHHHHHHh
Q 015659 291 LYYEVEMMDFI-KEKVPWEMNNQGKIEAAGRKKEEGNLLFKNGKYERAGKKYNKAADCVSEDGSFVDDEQKLVKSLRVSC 369 (403)
Q Consensus 291 l~f~iel~~i~-~~~~~~~m~~~e~~~~~~~~k~~Gn~~fk~~~~~~A~~~Y~~al~~l~~~~~~~~~~~~~~~~~~~~~ 369 (403)
|.|+|+|++|. +....|.|..+|++..|.+.|+.||.+||.|+|..|...|++|+++|++....++++.+.+..+++.|
T Consensus 180 l~yEVeL~~f~~~~~~s~~~~~~e~l~~A~~~ke~Gn~~fK~gk~~~A~~~Yerav~~l~~~~~~~~ee~~~~~~~k~~~ 259 (397)
T KOG0543|consen 180 LLYEVELLDFELKEDESWKMFAEERLEAADRKKERGNVLFKEGKFKLAKKRYERAVSFLEYRRSFDEEEQKKAEALKLAC 259 (397)
T ss_pred EEEEEEEEeeecCcccccccchHHHHHHHHHHHHhhhHHHhhchHHHHHHHHHHHHHHhhccccCCHHHHHHHHHHHHHH
Confidence 99999999999 89999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhHHHHHHHHccCHHHHHHHHHHHHhcccccCC
Q 015659 370 WLNSAACCLKLKDYQGAIELCSKVIVEREAARG 402 (403)
Q Consensus 370 ~~N~a~c~lkl~~~~~ai~~~~~aL~~dp~~~~ 402 (403)
|+|+|+||+|+++|..|+.+|++||+++|.|.+
T Consensus 260 ~lNlA~c~lKl~~~~~Ai~~c~kvLe~~~~N~K 292 (397)
T KOG0543|consen 260 HLNLAACYLKLKEYKEAIESCNKVLELDPNNVK 292 (397)
T ss_pred hhHHHHHHHhhhhHHHHHHHHHHHHhcCCCchh
Confidence 999999999999999999999999999999963
|
|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated | Back alignment and domain information |
|---|
| >PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 | Back alignment and domain information |
|---|
| >TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated | Back alignment and domain information |
|---|
| >PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 | Back alignment and domain information |
|---|
| >PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00115 tig trigger factor | Back alignment and domain information |
|---|
| >PRK01490 tig trigger factor; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR00115 tig trigger factor | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK01490 tig trigger factor; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00745 MIT Microtubule Interacting and Trafficking molecule domain | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 403 | ||||
| 3jym_A | 377 | Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk | 2e-47 | ||
| 3jxv_A | 356 | Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk | 4e-47 | ||
| 1kt1_A | 457 | Structure Of The Large Fkbp-Like Protein, Fkbp51, I | 8e-41 | ||
| 1kt0_A | 457 | Structure Of The Large Fkbp-like Protein, Fkbp51, I | 2e-40 | ||
| 3o5d_A | 264 | Crystal Structure Of A Fragment Of Fkbp51 Comprisin | 6e-26 | ||
| 1q1c_A | 280 | Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt | 1e-24 | ||
| 1qz2_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Compl | 6e-23 | ||
| 1p5q_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Lengt | 3e-21 | ||
| 2lgo_A | 130 | Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol | 4e-16 | ||
| 2if4_A | 338 | Crystal Structure Of A Multi-Domain Immunophilin Fr | 4e-16 | ||
| 1r9h_A | 135 | Structural Genomics Of C.Elegans: Fkbp-Type Peptidy | 8e-16 | ||
| 1r9h_A | 135 | Structural Genomics Of C.Elegans: Fkbp-Type Peptidy | 9e-07 | ||
| 4drj_A | 144 | O-crystal Structure Of The Ppiase Domain Of Fkbp52, | 3e-15 | ||
| 1n1a_A | 140 | Crystal Structure Of The N-Terminal Domain Of Human | 3e-15 | ||
| 1rot_A | 149 | Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 | 3e-15 | ||
| 4dz3_A | 113 | Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is | 1e-14 | ||
| 2y78_A | 133 | Crystal Structure Of Bpss1823, A Mip-Like Chaperone | 1e-14 | ||
| 2ke0_A | 117 | Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso | 1e-14 | ||
| 3vaw_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 2e-14 | ||
| 4ggq_C | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 2e-14 | ||
| 3uf8_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 2e-14 | ||
| 3uqa_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 2e-14 | ||
| 2ki3_A | 126 | Structural And Biochemical Characterization Of Fk50 | 3e-14 | ||
| 2ki3_A | 126 | Structural And Biochemical Characterization Of Fk50 | 4e-06 | ||
| 3o5e_A | 144 | Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 | 5e-14 | ||
| 3o5e_A | 144 | Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 | 3e-07 | ||
| 3o5g_A | 128 | Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 | 5e-14 | ||
| 3o5g_A | 128 | Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 | 2e-07 | ||
| 4drh_A | 144 | Co-crystal Structure Of The Ppiase Domain Of Fkbp51 | 6e-14 | ||
| 4drh_A | 144 | Co-crystal Structure Of The Ppiase Domain Of Fkbp51 | 2e-07 | ||
| 3o5l_A | 128 | Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le | 6e-14 | ||
| 3o5l_A | 128 | Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le | 2e-07 | ||
| 3uqb_A | 209 | Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C | 1e-13 | ||
| 1yat_A | 113 | Improved Calcineurin Inhibition By Yeast Fkbp12-Dru | 4e-13 | ||
| 4dz2_A | 113 | Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is | 5e-12 | ||
| 2vn1_A | 129 | Crystal Structure Of The Fk506-Binding Domain Of Pl | 7e-12 | ||
| 2vn1_A | 129 | Crystal Structure Of The Fk506-Binding Domain Of Pl | 1e-07 | ||
| 2ofn_A | 135 | Solution Structure Of Fk506-Binding Domain (Fkbd)of | 7e-12 | ||
| 2ofn_A | 135 | Solution Structure Of Fk506-Binding Domain (Fkbd)of | 1e-07 | ||
| 1pbk_A | 116 | Homologous Domain Of Human Fkbp25 Length = 116 | 2e-11 | ||
| 1pbk_A | 116 | Homologous Domain Of Human Fkbp25 Length = 116 | 1e-05 | ||
| 3kz7_A | 119 | C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple | 4e-11 | ||
| 2pbc_A | 102 | Fk506-Binding Protein 2 Length = 102 | 4e-11 | ||
| 2dg9_A | 107 | Fk506-Binding Protein Mutant Wl59 Complexed With Ra | 7e-11 | ||
| 1jvw_A | 167 | Trypanosoma Cruzi Macrophage Infectivity Potentiato | 1e-10 | ||
| 1c9h_A | 107 | Crystal Structure Of Fkbp12.6 In Complex With Rapam | 1e-10 | ||
| 1fkk_A | 107 | Atomic Structure Of Fkbp12, An Immunophilin Binding | 1e-10 | ||
| 3uqi_A | 108 | Crystallographic Structure Of Fkbp12 From Aedes Aeg | 2e-10 | ||
| 2dg4_A | 107 | Fk506-Binding Protein Mutant Wf59 Complexed With Ra | 2e-10 | ||
| 1tco_C | 107 | Ternary Complex Of A Calcineurin A Fragment, Calcin | 2e-10 | ||
| 3h9r_B | 109 | Crystal Structure Of The Kinase Domain Of Type I Ac | 3e-10 | ||
| 2fap_A | 107 | The Structure Of The Immunophilin-Immunosuppressant | 3e-10 | ||
| 2ppp_A | 107 | Crystal Structure Of E60q Mutant Of Fkbp12 Length = | 4e-10 | ||
| 1fkb_A | 107 | Atomic Structure Of The Rapamycin Human Immunophili | 6e-10 | ||
| 2ppo_A | 107 | Crystal Structure Of E60a Mutant Of Fkbp12 Length = | 6e-10 | ||
| 1eym_A | 107 | Fk506 Binding Protein Mutant, Homodimeric Complex L | 2e-09 | ||
| 1bkf_A | 107 | Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX | 2e-09 | ||
| 1u79_A | 129 | Crystal Structure Of Atfkbp13 Length = 129 | 2e-09 | ||
| 1bl4_A | 107 | Fkbp Mutant F36v Complexed With Remodeled Synthetic | 2e-09 | ||
| 1q6u_A | 245 | Crystal Structure Of Fkpa From Escherichia Coli Len | 3e-09 | ||
| 1q6h_A | 224 | Crystal Structure Of A Truncated Form Of Fkpa From | 3e-09 | ||
| 1fd9_A | 213 | Crystal Structure Of The Macrophage Infectivity Pot | 1e-05 | ||
| 2uz5_A | 137 | Solution Structure Of The Fkbp-Domain Of Legionella | 1e-05 | ||
| 2fbn_A | 198 | Plasmodium Falciparum Putative Fk506-Binding Protei | 2e-05 | ||
| 4dip_A | 125 | Crystal Structure Of Human Peptidyl-Prolyl Cis-Tran | 3e-05 | ||
| 3b7x_A | 134 | Crystal Structure Of Human Fk506-Binding Protein 6 | 3e-05 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 4e-05 | ||
| 4dt4_A | 169 | Crystal Structure Of The Ppiase-Chaperone Slpa With | 1e-04 |
| >pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 | Back alignment and structure |
|
| >pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 | Back alignment and structure |
| >pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 | Back alignment and structure |
| >pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 | Back alignment and structure |
| >pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 | Back alignment and structure |
| >pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 | Back alignment and structure |
| >pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 | Back alignment and structure |
| >pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 | Back alignment and structure |
| >pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 | Back alignment and structure |
| >pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 | Back alignment and structure |
| >pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 | Back alignment and structure |
| >pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 | Back alignment and structure |
| >pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 | Back alignment and structure |
| >pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 | Back alignment and structure |
| >pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 | Back alignment and structure |
| >pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 | Back alignment and structure |
| >pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 | Back alignment and structure |
| >pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 | Back alignment and structure |
| >pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 | Back alignment and structure |
| >pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 | Back alignment and structure |
| >pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 | Back alignment and structure |
| >pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 | Back alignment and structure |
| >pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 | Back alignment and structure |
| >pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 | Back alignment and structure |
| >pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 | Back alignment and structure |
| >pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 | Back alignment and structure |
| >pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 | Back alignment and structure |
| >pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 | Back alignment and structure |
| >pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 | Back alignment and structure |
| >pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 | Back alignment and structure |
| >pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 | Back alignment and structure |
| >pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 | Back alignment and structure |
| >pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 | Back alignment and structure |
| >pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 | Back alignment and structure |
| >pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 | Back alignment and structure |
| >pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 | Back alignment and structure |
| >pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 | Back alignment and structure |
| >pdb|2PBC|A Chain A, Fk506-Binding Protein 2 Length = 102 | Back alignment and structure |
| >pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Infectivity Potentiator (Tcmip) Length = 167 | Back alignment and structure |
| >pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 | Back alignment and structure |
| >pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 | Back alignment and structure |
| >pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 | Back alignment and structure |
| >pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 | Back alignment and structure |
| >pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 | Back alignment and structure |
| >pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 | Back alignment and structure |
| >pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 | Back alignment and structure |
| >pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 | Back alignment and structure |
| >pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 | Back alignment and structure |
| >pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 | Back alignment and structure |
| >pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 | Back alignment and structure |
| >pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 | Back alignment and structure |
| >pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 | Back alignment and structure |
| >pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From Escherichia Coli Length = 245 | Back alignment and structure |
| >pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated Form Of Fkpa From Escherichia Coli Length = 224 | Back alignment and structure |
| >pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 | Back alignment and structure |
| >pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 | Back alignment and structure |
| >pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 | Back alignment and structure |
| >pdb|4DIP|A Chain A, Crystal Structure Of Human Peptidyl-Prolyl Cis-Trans Isomerase Fkbp14 Length = 125 | Back alignment and structure |
| >pdb|3B7X|A Chain A, Crystal Structure Of Human Fk506-Binding Protein 6 Length = 134 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|4DT4|A Chain A, Crystal Structure Of The Ppiase-Chaperone Slpa With The Chaperone Binding Site Occupied By The Linker Of The Purification Tag Length = 169 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 403 | |||
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 2e-79 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 4e-64 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 1e-57 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 1e-56 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 3e-15 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 1e-51 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 4e-18 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 9e-45 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 3e-22 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 9e-38 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 9e-13 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 5e-35 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 1e-12 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 2e-34 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 2e-10 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 3e-34 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 2e-19 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 9e-34 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 5e-11 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 1e-33 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 3e-12 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 5e-33 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 3e-12 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 1e-32 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 6e-10 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 1e-32 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 6e-18 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 2e-32 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 2e-17 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 4e-32 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 2e-17 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 7e-32 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 4e-11 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 9e-32 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 3e-12 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 2e-30 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 3e-10 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 1e-29 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 3e-08 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 8e-29 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 5e-08 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 2e-28 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 4e-28 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 2e-08 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 6e-28 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 4e-08 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 7e-27 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 7e-08 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 9e-26 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 9e-23 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 6e-04 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 2e-22 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 4e-05 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 4e-20 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 2e-04 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 7e-20 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 2e-14 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 9e-14 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 2e-04 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 1e-10 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 5e-04 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 3e-10 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 4e-10 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 6e-10 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 3e-04 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 1e-09 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 1e-09 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 1e-09 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 1e-09 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 1e-09 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 1e-09 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 1e-09 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 1e-09 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 2e-09 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 2e-09 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 4e-09 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 4e-09 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 1e-08 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-08 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 3e-05 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 7e-05 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 7e-08 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-06 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-05 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 2e-07 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 3e-07 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 5e-07 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-05 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-04 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 1e-05 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 1e-05 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 3e-05 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 5e-05 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 5e-05 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 6e-04 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 7e-04 |
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
Score = 251 bits (641), Expect = 2e-79
Identities = 116/392 (29%), Positives = 182/392 (46%), Gaps = 52/392 (13%)
Query: 7 MTLEKGANLSDIDGEEEEPGEVIESAAPLKVGEERGLGNSGIKKKLLKNGVDWDTPEFGD 66
MT ++GA + EE V E + + G+ K + + G +TP GD
Sbjct: 1 MTTDEGAK----NNEESPTATVAEQGEDITS-----KKDRGVLKIVKRVGNGEETPMIGD 51
Query: 67 EVTIHYVGTLLDGTKFDSTRDRYDPLTFKLGTGQVATGLDNGIITMKKRECAVFTFTLPS 126
+V +HY G L +G KFDS+ DR +P F LG GQV D G+ TMK+ E
Sbjct: 52 KVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKRGEIC--HLLCKP 109
Query: 127 ELRFGVEGR-DSLPPNSVVQFEVELVSWITVVDLSKDGGIVKKILEKGERDASPGDLDEV 185
E +G G +P N+ + FE+EL+ + DL +DGGI+++ KGE ++P + V
Sbjct: 110 EYAYGSAGSLPKIPSNATLFFEIELLDFKGE-DLFEDGGIIRRTKRKGEGYSNPNEGATV 168
Query: 186 LVKYQVMLGDGTMVAKTPEEGVEFYLKDVSYIARLEDGTVFEKKGYDGEQPLEFIT---D 242
+ + G +F+ + + F +
Sbjct: 169 EIHLEGRC----------------------------GGRMFD------CRDVAFTVGEGE 194
Query: 243 EEQVIAGLDRVAATMKKEEWAIVTINHEYGFGNVEAKRDLATIPSCAKLYYEVEMMDFIK 302
+ + G+D+ M++EE I+ + YGFG EA + I A+L YEV + F K
Sbjct: 195 DHDIPIGIDKALEKMQREEQCILYLGPRYGFG--EAGKPKFGIEPNAELIYEVTLKSFEK 252
Query: 303 EKVPWEMNNQGKIEAAGRKKEEGNLLFKNGKYERAGKKYNKAADCVSEDGSFVDDEQKLV 362
K WEM+ + K+E A KE+G + FK GKY +A +Y K + + + E K
Sbjct: 253 AKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKAS 312
Query: 363 KSLRVSCWLNSAACCLKLKDYQGAIELCSKVI 394
+S ++ +LN A C LKL++Y A+E C K +
Sbjct: 313 ESFLLAAFLNLAMCYLKLREYTKAVECCDKAL 344
|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Length = 171 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Length = 151 | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Length = 196 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Length = 151 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} PDB: 3pra_A Length = 157 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Length = 231 | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Length = 158 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 403 | |||
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 100.0 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 100.0 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 100.0 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.97 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.96 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.92 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.91 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 99.91 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 99.9 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.9 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 99.9 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 99.9 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 99.9 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 99.89 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 99.89 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 99.89 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 99.89 | |
| 2lkn_A | 165 | AH receptor-interacting protein; FKBP-type domain, | 99.89 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 99.89 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 99.88 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 99.88 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 99.88 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 99.88 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 99.88 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.88 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 99.88 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 99.88 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 99.88 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 99.87 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.87 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 99.87 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 99.87 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 99.86 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 99.86 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 99.86 | |
| 2lkn_A | 165 | AH receptor-interacting protein; FKBP-type domain, | 99.86 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 99.85 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 99.85 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 99.85 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 99.85 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 99.84 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 99.83 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 99.83 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 99.83 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 99.82 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.82 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 99.82 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 99.82 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 99.82 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 99.82 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 99.79 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 99.79 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 99.78 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 99.78 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 99.77 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 99.77 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 99.77 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 99.75 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 99.73 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 99.72 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 99.72 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 99.72 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 99.69 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 99.63 | |
| 1hxv_A | 113 | Trigger factor; FKBP fold, ppiase, chaperone; NMR | 99.61 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 99.54 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 99.5 | |
| 1hxv_A | 113 | Trigger factor; FKBP fold, ppiase, chaperone; NMR | 99.48 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 99.45 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 99.44 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 99.42 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 99.41 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 99.39 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.31 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 99.26 | |
| 1w26_A | 432 | Trigger factor, TF; chaperone, protein folding, ri | 99.15 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.11 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.08 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.05 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.05 | |
| 1t11_A | 392 | Trigger factor, TF; helix-turn-helix, four-helix-b | 98.97 | |
| 1w26_A | 432 | Trigger factor, TF; chaperone, protein folding, ri | 98.94 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.79 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.69 | |
| 1t11_A | 392 | Trigger factor, TF; helix-turn-helix, four-helix-b | 98.66 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.63 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 98.47 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.47 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 98.46 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.46 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.34 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.3 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.28 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.28 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 98.28 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.27 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.26 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 98.26 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.23 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.2 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.2 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.19 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.19 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.18 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.14 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.13 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.12 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.11 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.07 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.06 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.06 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.05 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.03 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 98.0 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.99 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.99 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 97.99 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.99 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 97.96 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 97.94 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.93 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.92 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 97.9 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 97.9 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.89 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.88 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.88 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 97.83 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 97.83 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.83 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 97.82 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 97.78 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 97.77 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 97.76 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 97.75 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 97.75 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.73 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.72 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.68 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 97.67 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.67 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 97.66 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.66 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 97.64 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 97.63 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 97.63 | |
| 3gty_X | 433 | Trigger factor, TF; chaperone-client complex, cell | 97.62 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 97.61 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 97.61 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 97.6 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 97.59 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.59 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.58 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 97.51 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 97.51 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.5 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 97.5 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.48 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.45 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 97.42 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.42 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.42 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.42 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.42 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 97.41 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.38 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.37 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 97.34 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 97.33 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.33 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 97.32 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.27 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 97.26 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.25 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 97.22 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.2 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.2 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 97.2 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 97.19 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.19 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.17 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.16 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 97.15 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.14 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 97.13 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 97.12 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.12 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.11 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.11 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 97.09 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 97.08 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.07 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 97.07 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 97.07 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.05 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.05 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.05 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.05 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.04 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.04 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.04 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 97.02 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.0 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.0 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 96.99 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.99 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 96.97 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 96.97 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 96.94 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 96.94 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 96.93 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 96.92 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 96.9 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 96.9 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.9 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 96.88 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 96.86 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 96.84 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 96.84 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 96.82 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.82 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 96.82 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 96.81 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 96.81 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 96.8 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 96.78 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 96.76 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.73 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 96.71 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 96.7 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 96.68 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 96.65 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 96.64 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 96.64 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 96.63 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 96.56 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 96.54 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 96.48 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 96.47 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 96.39 | |
| 3gty_X | 433 | Trigger factor, TF; chaperone-client complex, cell | 96.39 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 96.38 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 96.35 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 96.28 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 96.28 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 96.2 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 95.66 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.62 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 95.54 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 95.52 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 95.49 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 95.37 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 95.33 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 95.19 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 95.17 | |
| 2v6y_A | 83 | AAA family ATPase, P60 katanin; MIT, VPS4, archaea | 95.15 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 95.0 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 94.86 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 94.79 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 94.57 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 94.39 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 94.2 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 94.07 | |
| 2cpt_A | 117 | SKD1 protein, vacuolar sorting protein 4B; MIT, he | 93.63 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 93.5 | |
| 2v6x_A | 85 | Vacuolar protein sorting-associated protein 4; pro | 93.41 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 93.37 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 93.32 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 93.18 | |
| 2w2u_A | 83 | Hypothetical P60 katanin; hydrolase transport comp | 93.07 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 92.82 | |
| 1wfd_A | 93 | Hypothetical protein 1500032H18; MIT domain, struc | 92.29 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 92.29 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 92.25 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 92.04 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 91.95 | |
| 4a5x_A | 86 | MITD1, MIT domain-containing protein 1; protein tr | 91.95 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 91.69 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 91.66 | |
| 3mv2_A | 325 | Coatomer subunit alpha; vesicular membrane coat CO | 91.48 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 91.09 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 90.81 | |
| 3mkr_B | 320 | Coatomer subunit alpha; tetratricopeptide repeats | 90.31 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 90.12 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 89.65 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 88.66 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 88.6 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 88.48 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 87.7 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 87.51 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 87.3 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 87.27 | |
| 2crb_A | 97 | Nuclear receptor binding factor 2; NRBF-2, MIT dom | 86.04 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 85.55 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 85.22 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 83.73 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 83.67 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 83.01 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 82.83 | |
| 2vkj_A | 106 | TM1634; membrane protein, TPR motif joint center f | 82.56 | |
| 2dl1_A | 116 | Spartin; SPG20, MIT, structural genomics, NPPSFA, | 82.16 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 80.47 |
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.9e-50 Score=406.86 Aligned_cols=327 Identities=34% Similarity=0.585 Sum_probs=275.0
Q ss_pred cCCCcee-ecCCCeEEEEEEccCCCCCCCCCCEEEEEEEEEEcCCcEEeccCCCCCCeeEEeCCCccchhHHHhhcCccc
Q 015659 36 KVGEERG-LGNSGIKKKLLKNGVDWDTPEFGDEVTIHYVGTLLDGTKFDSTRDRYDPLTFKLGTGQVATGLDNGIITMKK 114 (403)
Q Consensus 36 ~~~~~~~-~~~~g~~~~vl~~G~G~~~~~~gd~V~v~y~~~~~~g~~~~ss~~~~~p~~~~lG~~~~~~gl~~al~~m~~ 114 (403)
..+.++. .+++|++|+++++|+|...|..||.|+|||++++.||++|++|+.++.|+.|.+|.+++++||+++|.+|++
T Consensus 20 ~~~~~~~~~~~~g~~~~~~~~G~g~~~~~~gd~v~v~y~~~~~~g~~~dss~~~~~p~~~~~g~~~~i~g~~~~l~~m~~ 99 (457)
T 1kt0_A 20 EQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKR 99 (457)
T ss_dssp -------------CEEEC--------CCCBTCEEEEEEEEEC-----CBC------CEEEETTSTTSCHHHHHHHTTCCT
T ss_pred CCcccccCCCCCcEEEEEEECCCCCCCCCCCCEEEEEEEEEECCCCEEeccCCCCCCeEEEeCCcchhhHHHHHHhhCCC
Confidence 3455553 579999999999999954599999999999999989999999998889999999999999999999999999
Q ss_pred CcEEEEEEEcCCCCCCCCCCCC-CCCCCCeEEEEEEeccceeeeccCCCcceeeEEeecCCcCCCCCCCCceEEEEEeee
Q 015659 115 RECAVFTFTLPSELRFGVEGRD-SLPPNSVVQFEVELVSWITVVDLSKDGGIVKKILEKGERDASPGDLDEVLVKYQVML 193 (403)
Q Consensus 115 Ge~~~v~~~vp~~~ayg~~~~~-~ip~~~~l~~~v~l~~~~~~~dv~~d~~v~k~il~~G~g~~~p~~~~~V~i~y~~~l 193 (403)
|++++| +|||+++||..|.+ .||++++++|+|+|+++... ++..|++++++++.+|.++..|..++.|++|
T Consensus 100 Ge~~~~--~i~~~~~yg~~g~~~~i~~~~~l~~~v~l~~~~~~-~~~~dg~~~k~i~~~g~~~~~p~~g~~V~v~----- 171 (457)
T 1kt0_A 100 GEICHL--LCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE-DLFEDGGIIRRTKRKGEGYSNPNEGATVEIH----- 171 (457)
T ss_dssp TCEEEE--EECGGGTTTTTCBTTTBCTTCCEEEEEEEEEEECE-ETTSSSSEEEEEEECCBCSCCCCTTCEEEEE-----
T ss_pred CCEEEE--EEChHHhccccCCCCCCCCCCcEEEEEeeceeecc-cccCCcceEEEEEecCCCCCCCCCCCEEEEE-----
Confidence 999999 99999999999876 89999999999999998754 6778999999999999999999999988876
Q ss_pred CCCceeecCCCCceeEEeeceEEEEeeccceEEeecCCCCCCCeEEEcCCC---CcchHHHHHHcccCCCcEEEEEEcCC
Q 015659 194 GDGTMVAKTPEEGVEFYLKDVSYIARLEDGTVFEKKGYDGEQPLEFITDEE---QVIAGLDRVAATMKKEEWAIVTINHE 270 (403)
Q Consensus 194 ~~~~~v~~~~~~g~~~~~~~v~y~g~~~~g~~fd~s~~~~~~p~~~~lG~~---~v~~gl~~~l~~m~~Ge~~~v~i~~~ 270 (403)
|+|++ +|++||++ +++|.+|++ .++++|+.|+..|+.||++.|.++|.
T Consensus 172 ----------------------y~g~~-~g~~f~~~------~~~f~~g~g~~~~v~~~~e~al~~~~~ge~~~l~i~P~ 222 (457)
T 1kt0_A 172 ----------------------LEGRC-GGRMFDCR------DVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPR 222 (457)
T ss_dssp ----------------------EEEEE-TTEEEEEE------EEEEETTCGGGGTCCHHHHHHHTTCCBTCEEEEEECGG
T ss_pred ----------------------EEEEe-CCeEEecC------ceEEEeCCCccccCChHHHHHHHhCCCCCEEEEEECcc
Confidence 55666 77889875 599999976 48999999999999999999999999
Q ss_pred CCCCCcccccCCCCCCCCCeEEEEEEEeeeccCcCccccCchHHHHHHHHHHHHhhHhhhcCcHHHHHHHHHHHHHHhcc
Q 015659 271 YGFGNVEAKRDLATIPSCAKLYYEVEMMDFIKEKVPWEMNNQGKIEAAGRKKEEGNLLFKNGKYERAGKKYNKAADCVSE 350 (403)
Q Consensus 271 ~~yg~~~~~~~~~~ip~~~~l~f~iel~~i~~~~~~~~m~~~e~~~~~~~~k~~Gn~~fk~~~~~~A~~~Y~~al~~l~~ 350 (403)
++|+..+... ..|||++.+.|.++|.++++....|.+..+++...+..++..|+.+|+.|+|..|+..|++|+.+...
T Consensus 223 ~ay~~~g~~~--~~ip~~~~l~y~~~l~~~~~A~~~~~~~~~~~~~~a~~~~~~G~~~~~~g~~~~A~~~y~~Al~~~p~ 300 (457)
T 1kt0_A 223 YGFGEAGKPK--FGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM 300 (457)
T ss_dssp GTTCSSCBGG--GTBCTTCCEEEEEEEEEEECCCCGGGSCHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTT
T ss_pred cccCCCCCcc--cCCCCCCEEEEEhhhhhcccCcchhhcCHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHhcc
Confidence 9999988632 47999999999999999999999999999999999999999999999999999999999999998877
Q ss_pred CCCCChHHHHHHHHHHHHhhhHHHHHHHHccCHHHHHHHHHHHHhcccccC
Q 015659 351 DGSFVDDEQKLVKSLRVSCWLNSAACCLKLKDYQGAIELCSKVIVEREAAR 401 (403)
Q Consensus 351 ~~~~~~~~~~~~~~~~~~~~~N~a~c~lkl~~~~~ai~~~~~aL~~dp~~~ 401 (403)
.....+++..++..+...+++|+|.||+++++|.+|+.+|++||+++|.|.
T Consensus 301 ~~~~~~~~~~~~~~~~~~~~~nla~~~~~~g~~~~A~~~~~~al~~~p~~~ 351 (457)
T 1kt0_A 301 EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANE 351 (457)
T ss_dssp CCSCCHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSTTCH
T ss_pred cccCChHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCccH
Confidence 766778888889999999999999999999999999999999999999874
|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... | Back alignment and structure |
|---|
| >2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* | Back alignment and structure |
|---|
| >1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A | Back alignment and structure |
|---|
| >1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* | Back alignment and structure |
|---|
| >1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A | Back alignment and structure |
|---|
| >1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2vkj_A TM1634; membrane protein, TPR motif joint center for structural GENO JCSG, structural genomics; 1.65A {Thermotoga maritima} PDB: 2vko_A* | Back alignment and structure |
|---|
| >2dl1_A Spartin; SPG20, MIT, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 403 | ||||
| d1r9ha_ | 118 | d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd | 2e-22 | |
| d1r9ha_ | 118 | d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd | 4e-12 | |
| d1q1ca1 | 120 | d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu | 2e-20 | |
| d1q1ca1 | 120 | d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu | 1e-08 | |
| d1kt1a2 | 111 | d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo | 3e-19 | |
| d1kt1a2 | 111 | d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo | 3e-09 | |
| d1kt1a3 | 115 | d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M | 5e-18 | |
| d1kt1a3 | 115 | d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M | 4e-13 | |
| d1pbka_ | 116 | d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: | 2e-17 | |
| d1pbka_ | 116 | d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: | 1e-08 | |
| d1q6ha_ | 210 | d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 6e-16 | |
| d1q6ha_ | 210 | d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 8e-07 | |
| d1yata_ | 113 | d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas | 1e-15 | |
| d1yata_ | 113 | d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas | 4e-05 | |
| d1q1ca2 | 117 | d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H | 2e-15 | |
| d1q1ca2 | 117 | d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H | 1e-11 | |
| d2ppna1 | 107 | d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) | 3e-15 | |
| d2ppna1 | 107 | d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) | 0.001 | |
| d1fd9a_ | 204 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 1e-13 | |
| d1fd9a_ | 204 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 5e-05 | |
| d1jvwa_ | 160 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 2e-12 | |
| d1jvwa_ | 160 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 9e-05 | |
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 2e-12 | |
| d1p5qa1 | 170 | a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d | 2e-12 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 7e-12 | |
| d1ix5a_ | 151 | d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu | 2e-10 | |
| d1ix5a_ | 151 | d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu | 0.003 | |
| d1u79a_ | 125 | d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha | 1e-09 | |
| d1hxva_ | 85 | d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl | 2e-09 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 4e-05 | |
| d1ihga1 | 169 | a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau | 2e-04 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 2e-04 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 4e-04 | |
| d1elwa_ | 117 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 0.002 | |
| d2hr2a1 | 156 | a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C | 0.003 |
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: FKB-6, N-terminal domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 89.4 bits (221), Expect = 2e-22
Identities = 48/111 (43%), Positives = 62/111 (55%), Gaps = 3/111 (2%)
Query: 44 GNSGIKKKLLKNGVDWDTPEFGDEVTIHYVGTLLDGTKFDSTRDRYDPLTFKLGTGQVAT 103
+ G+ K + K G P G V +HYVGTL +GTKFDS+RDR D +F LG G V
Sbjct: 8 KDGGVLKLIKKEGQGVVKPTTGTTVKVHYVGTLENGTKFDSSRDRGDQFSFNLGRGNVIK 67
Query: 104 GLDNGIITMKKRECAVFTFTLPSELRFGVEGR-DSLPPNSVVQFEVELVSW 153
G D G+ TM K E A FT+ S+ +G G +P + + FEVEL W
Sbjct: 68 GWDLGVATMTKGEVA--EFTIRSDYGYGDAGSPPKIPGGATLIFEVELFEW 116
|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 403 | |||
| d1q1ca1 | 120 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.93 | |
| d1r9ha_ | 118 | FKB-6, N-terminal domain {Caenorhabditis elegans [ | 99.93 | |
| d1q1ca1 | 120 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.92 | |
| d1kt1a2 | 111 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.92 | |
| d2ppna1 | 107 | FK-506 binding protein (FKBP12), an immunophilin { | 99.92 | |
| d1yata_ | 113 | Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc | 99.92 | |
| d1r9ha_ | 118 | FKB-6, N-terminal domain {Caenorhabditis elegans [ | 99.92 | |
| d1q6ha_ | 210 | Peptidyl-prolyl cis-trans isomerase FkpA {Escheric | 99.91 | |
| d1fd9a_ | 204 | Macrophage infectivity potentiator protein (MIP) { | 99.91 | |
| d1kt1a2 | 111 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.9 | |
| d2ppna1 | 107 | FK-506 binding protein (FKBP12), an immunophilin { | 99.9 | |
| d1pbka_ | 116 | FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1yata_ | 113 | Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc | 99.89 | |
| d1pbka_ | 116 | FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1u79a_ | 125 | FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: | 99.89 | |
| d1jvwa_ | 160 | Macrophage infectivity potentiator protein (MIP) { | 99.88 | |
| d1kt1a3 | 115 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.87 | |
| d1jvwa_ | 160 | Macrophage infectivity potentiator protein (MIP) { | 99.85 | |
| d1fd9a_ | 204 | Macrophage infectivity potentiator protein (MIP) { | 99.85 | |
| d1q6ha_ | 210 | Peptidyl-prolyl cis-trans isomerase FkpA {Escheric | 99.84 | |
| d1kt1a3 | 115 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 99.84 | |
| d1q1ca2 | 117 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.82 | |
| d1q1ca2 | 117 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 99.8 | |
| d1u79a_ | 125 | FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: | 99.79 | |
| d1ix5a_ | 151 | Archaeal FKBP {Archaeon Methanococcus thermolithot | 99.71 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.7 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.66 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.66 | |
| d1ix5a_ | 151 | Archaeal FKBP {Archaeon Methanococcus thermolithot | 99.45 | |
| d1hxva_ | 85 | Trigger factor PPIase domain {Mycoplasma genitaliu | 99.4 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.27 | |
| d1hxva_ | 85 | Trigger factor PPIase domain {Mycoplasma genitaliu | 99.24 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.15 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.14 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.11 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.08 | |
| d1l1pa_ | 106 | Trigger factor PPIase domain {Escherichia coli [Ta | 98.91 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.88 | |
| d1t11a3 | 113 | Trigger factor PPIase domain {Vibrio cholerae [Tax | 98.84 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.74 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.4 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.39 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.37 | |
| d1l1pa_ | 106 | Trigger factor PPIase domain {Escherichia coli [Ta | 98.35 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.35 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.31 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 98.27 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.26 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.24 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.22 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.21 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.18 | |
| d1t11a3 | 113 | Trigger factor PPIase domain {Vibrio cholerae [Tax | 98.17 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.14 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.09 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.04 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.89 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.83 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.81 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.66 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 97.66 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.63 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.62 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.62 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.51 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.38 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 97.38 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.36 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 97.34 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 97.24 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.19 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 97.07 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 97.0 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 96.84 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 96.63 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 96.04 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 95.96 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 95.4 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 95.06 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 95.03 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 94.46 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 92.39 | |
| d1wr0a1 | 77 | Vacuolar sorting protein 4b (VPS4B, SKD1 protein) | 92.17 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 90.46 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 90.24 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 80.82 |
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FKBP-like superfamily: FKBP-like family: FKBP immunophilin/proline isomerase domain: FKBP52, N-terminal domains species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=2.2e-25 Score=179.99 Aligned_cols=110 Identities=41% Similarity=0.675 Sum_probs=104.7
Q ss_pred ecCCCeEEEEEEccCCCCCCCCCCEEEEEEEEEEcCCcEEeccCCCCCCeeEEeCCCccchhHHHhhcCcccCcEEEEEE
Q 015659 43 LGNSGIKKKLLKNGVDWDTPEFGDEVTIHYVGTLLDGTKFDSTRDRYDPLTFKLGTGQVATGLDNGIITMKKRECAVFTF 122 (403)
Q Consensus 43 ~~~~g~~~~vl~~G~G~~~~~~gd~V~v~y~~~~~~g~~~~ss~~~~~p~~~~lG~~~~~~gl~~al~~m~~Ge~~~v~~ 122 (403)
..++||+|+++++|.|...|..||.|.|||++++.||++|++|+.++.|+.|.+|.+++++||+++|.+|++|++++|
T Consensus 8 ~~d~gv~~~i~~~G~G~~~P~~gd~V~v~y~~~l~dG~~fdss~~~~~p~~f~~g~~~~i~G~~~~l~~M~~Ge~~~~-- 85 (120)
T d1q1ca1 8 KQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHI-- 85 (120)
T ss_dssp SCSSSEEEEEEECCSSSCCCCTTCEEEEEEEEEETTSCEEEESTTSSSCEEEETTTTSSCHHHHHHHTTCCTTCEEEE--
T ss_pred CCCCCEEEEEEEcccCCcCCCCCCEEEEEEEEEEcCCCEEEeccccccceeeecCCCceeeeeeeeeccccCCcEEEE--
Confidence 356999999999999977799999999999999999999999999889999999999999999999999999999999
Q ss_pred EcCCCCCCCCCCCC-CCCCCCeEEEEEEeccce
Q 015659 123 TLPSELRFGVEGRD-SLPPNSVVQFEVELVSWI 154 (403)
Q Consensus 123 ~vp~~~ayg~~~~~-~ip~~~~l~~~v~l~~~~ 154 (403)
.|||++|||..+.+ .|||+++|+|+|+|++++
T Consensus 86 ~ip~~laYG~~g~~~~IPp~s~LifeIeLl~v~ 118 (120)
T d1q1ca1 86 TCKPEYAYGSAGSPPKIPPNATLVFEVELFEFK 118 (120)
T ss_dssp EECGGGTTTTTCBTTTBCTTCCEEEEEEEEEEE
T ss_pred EECHHHhCCCcCCCCCCCcCCcEEEEEEEEEEe
Confidence 99999999999976 899999999999999985
|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|