Citrus Sinensis ID: 015704

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400--
MGQINTWIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA
ccHHHHHcccccEEEEEcccccHHHHHHcccccEEEEEccccccHHHHHHHHHcccccHHHHccccccccccccccEEEEcccccccccccccccEEEccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHEEEEEEEEcEEEEEcccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHcccccEEEEEEEccccccccccEEcccccccccccccccccccccccHHHccccccccccccccccEEEEEccccccccEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEEEccccc
cccEEcccccEEEEEEccccHccHHHHHHcccEEEEEcccccHHHHHHHHHHHccccEEEEEHcccccccccccEEEHEcccccccccccccEEEEEEHHEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHcccccccccccccccccccccEcccHHccccccccccccccccccHHcccccccHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEHEcHHHccHHHHHHHHcccccEEEEEEEcccccccccEEEcccEEEEEcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEEEcEEcc
MGQINTWIRLLRVVMDAGcgvasfgayllprnvitmsiapkdvhENQIQFALERGAPAMVAAFAtrrlpypsqafdlihcsrcrinwtrddgILLLEVNRMLRAggyfawaaqpvykheeaQEEHWKEMLDLTTRLCWELVKKEGYIAiwkkptnnscylnreagtipplcdpddnpdnvwyVDLKACItrlpengyganvslwperlrtspdrlQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFdcwvmnvvpvsgfntlpviydrgligvmhdwcepfdtyprtYDLLHAAGLFSVESKRCNMSTIMLEMDRmlrpgghvyirdSIDVMDELQEIGKAMGWHVTlretaegphasyRILTADKRLLHA
MGQINTWIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIaiwkkptnnscYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRetaegphasyriltadkrllha
MGQINTWIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIpplcdpddnpdnVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA
***INTWIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILT********
**QINTWIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNN*CY***********CD*DDNPDNVWYVDLKACIT*****************LRT****************KELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETA**PHASYRILTADKRLLHA
MGQINTWIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA
*GQINTWIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQINTWIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query402 2.2.26 [Sep-21-2011]
O22285694 Probable methyltransferas yes no 0.987 0.572 0.806 0.0
Q9FG39682 Probable methyltransferas no no 0.965 0.568 0.809 0.0
Q94KE1655 Probable methyltransferas no no 0.965 0.592 0.765 0.0
Q8H118611 Probable methyltransferas no no 0.910 0.599 0.488 1e-104
Q93YV7608 Probable methyltransferas no no 0.890 0.588 0.490 1e-103
Q0WT31770 Probable methyltransferas no no 0.932 0.487 0.471 1e-103
Q9SD39895 Probable methyltransferas no no 0.950 0.426 0.470 1e-101
Q940J9623 Probable methyltransferas no no 0.905 0.584 0.485 1e-101
Q8L7V3829 Probable methyltransferas no no 0.932 0.452 0.465 1e-101
Q6NPR7770 Probable methyltransferas no no 0.935 0.488 0.475 1e-101
>sp|O22285|PMTB_ARATH Probable methyltransferase PMT11 OS=Arabidopsis thaliana GN=At2g39750 PE=2 SV=1 Back     alignment and function desciption
 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/397 (80%), Positives = 353/397 (88%)

Query: 6   TWIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFAT 65
           T+ + +RV MD GCGVASFGAYLL R+V+TMS+APKDVHENQIQFALERG PAM AAFAT
Sbjct: 298 TFGKHIRVAMDVGCGVASFGAYLLSRDVMTMSVAPKDVHENQIQFALERGVPAMAAAFAT 357

Query: 66  RRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEH 125
           RRL YPSQAFDLIHCSRCRINWTRDDGILLLE+NRMLRAGGYFAWAAQPVYKHE A EE 
Sbjct: 358 RRLLYPSQAFDLIHCSRCRINWTRDDGILLLEINRMLRAGGYFAWAAQPVYKHEPALEEQ 417

Query: 126 WKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDL 185
           W EML+LT  LCW+LVKKEGY+AIW+KP NN CYL+REAGT PPLCD  D+PDNVWY +L
Sbjct: 418 WTEMLNLTISLCWKLVKKEGYVAIWQKPFNNDCYLSREAGTKPPLCDESDDPDNVWYTNL 477

Query: 186 KACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYV 245
           K CI+R+PE GYG NV LWP RL T PDRLQ+I+ D++IARKELFKAESKYWNEII  YV
Sbjct: 478 KPCISRIPEKGYGGNVPLWPARLHTPPDRLQTIKFDSYIARKELFKAESKYWNEIIGGYV 537

Query: 246 RALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVM 305
           RAL WKKMKLRNVLDMRAGFGGFAAAL + K DCWV++VVPVSG NTLPVIYDRGL+GVM
Sbjct: 538 RALKWKKMKLRNVLDMRAGFGGFAAALNDHKLDCWVLSVVPVSGPNTLPVIYDRGLLGVM 597

Query: 306 HDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDE 365
           HDWCEPFDTYPRTYD LHA+GLFS+E KRC MSTI+LEMDR+LRPGG  YIRDSIDVMDE
Sbjct: 598 HDWCEPFDTYPRTYDFLHASGLFSIERKRCEMSTILLEMDRILRPGGRAYIRDSIDVMDE 657

Query: 366 LQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA 402
           +QEI KAMGWH +LR+T+EGPHASYRILT +KRLL A
Sbjct: 658 IQEITKAMGWHTSLRDTSEGPHASYRILTCEKRLLRA 694

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9FG39|PMTC_ARATH Probable methyltransferase PMT12 OS=Arabidopsis thaliana GN=At5g06050 PE=2 SV=1 Back     alignment and function description
>sp|Q94KE1|PMTA_ARATH Probable methyltransferase PMT10 OS=Arabidopsis thaliana GN=At1g77260 PE=2 SV=1 Back     alignment and function description
>sp|Q8H118|PMT1_ARATH Probable methyltransferase PMT1 OS=Arabidopsis thaliana GN=At3g23300 PE=1 SV=2 Back     alignment and function description
>sp|Q93YV7|PMT3_ARATH Probable methyltransferase PMT3 OS=Arabidopsis thaliana GN=At4g14360 PE=1 SV=1 Back     alignment and function description
>sp|Q0WT31|PMTP_ARATH Probable methyltransferase PMT25 OS=Arabidopsis thaliana GN=At2g34300 PE=1 SV=2 Back     alignment and function description
>sp|Q9SD39|PMTR_ARATH Probable methyltransferase PMT27 OS=Arabidopsis thaliana GN=At3g51070 PE=3 SV=1 Back     alignment and function description
>sp|Q940J9|PMT8_ARATH Probable methyltransferase PMT8 OS=Arabidopsis thaliana GN=At1g04430 PE=1 SV=1 Back     alignment and function description
>sp|Q8L7V3|PMTQ_ARATH Probable methyltransferase PMT26 OS=Arabidopsis thaliana GN=At5g64030 PE=1 SV=1 Back     alignment and function description
>sp|Q6NPR7|PMTO_ARATH Probable methyltransferase PMT24 OS=Arabidopsis thaliana GN=At1g29470 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query402
255566464 673 ATP binding protein, putative [Ricinus c 0.967 0.578 0.843 0.0
224101039 664 predicted protein [Populus trichocarpa] 0.975 0.590 0.831 0.0
297827583 689 dehydration-responsive family protein [A 0.987 0.576 0.806 0.0
18405149 694 putative methyltransferase PMT11 [Arabid 0.987 0.572 0.806 0.0
449465844 678 PREDICTED: probable methyltransferase PM 0.972 0.576 0.818 0.0
297806625 681 hypothetical protein ARALYDRAFT_487406 [ 0.965 0.569 0.809 0.0
15239326 682 putative methyltransferase PMT12 [Arabid 0.965 0.568 0.809 0.0
356553821 664 PREDICTED: probable methyltransferase PM 0.967 0.585 0.812 0.0
356499127 658 PREDICTED: probable methyltransferase PM 0.967 0.591 0.807 0.0
449476436 679 PREDICTED: probable methyltransferase PM 0.972 0.575 0.828 0.0
>gi|255566464|ref|XP_002524217.1| ATP binding protein, putative [Ricinus communis] gi|223536494|gb|EEF38141.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/389 (84%), Positives = 356/389 (91%)

Query: 12  RVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYP 71
           RVV+D GCGVASFGAYLL RNV+TMS+APKDVHENQIQFALERG PAMV AFAT RL YP
Sbjct: 283 RVVLDVGCGVASFGAYLLSRNVLTMSVAPKDVHENQIQFALERGVPAMVVAFATHRLLYP 342

Query: 72  SQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLD 131
           SQAF++IHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHE   EE W+EML+
Sbjct: 343 SQAFEIIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEAILEEQWEEMLN 402

Query: 132 LTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITR 191
           LTTRLCW LVKKEGYIAIW+KP NNSCYL+RE GT PPLCDPDDNPDNVWYVDLKACITR
Sbjct: 403 LTTRLCWTLVKKEGYIAIWQKPINNSCYLSREEGTKPPLCDPDDNPDNVWYVDLKACITR 462

Query: 192 LPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWK 251
           LPE+GYGAN++ WP RL T PDRLQSIQLDA+I+RKELFKAESKYW EII  YVRA HWK
Sbjct: 463 LPEDGYGANITTWPARLHTPPDRLQSIQLDAYISRKELFKAESKYWYEIIAGYVRAWHWK 522

Query: 252 KMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEP 311
           K KLRNVLDM+AGFGGFAAALI+Q+FDCWV+NVVP+SG NTLPVIYDRGL+GVMHDWCEP
Sbjct: 523 KFKLRNVLDMKAGFGGFAAALIDQQFDCWVLNVVPISGPNTLPVIYDRGLLGVMHDWCEP 582

Query: 312 FDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGK 371
           FDTYPRTYDLLHA GLFS+E KRC++STIMLEMDR+LRPGG  YIRD++DVMDELQE  K
Sbjct: 583 FDTYPRTYDLLHANGLFSIEKKRCSISTIMLEMDRILRPGGRAYIRDTLDVMDELQETAK 642

Query: 372 AMGWHVTLRETAEGPHASYRILTADKRLL 400
           AMGWHV L +T+EGPHASYRILT DKRLL
Sbjct: 643 AMGWHVALHDTSEGPHASYRILTCDKRLL 671

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224101039|ref|XP_002312116.1| predicted protein [Populus trichocarpa] gi|222851936|gb|EEE89483.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297827583|ref|XP_002881674.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. lyrata] gi|297327513|gb|EFH57933.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18405149|ref|NP_030521.1| putative methyltransferase PMT11 [Arabidopsis thaliana] gi|75097411|sp|O22285.1|PMTB_ARATH RecName: Full=Probable methyltransferase PMT11 gi|2642157|gb|AAB87124.1| expressed protein [Arabidopsis thaliana] gi|15450749|gb|AAK96646.1| At2g39750/T5I7.5 [Arabidopsis thaliana] gi|21700885|gb|AAM70566.1| At2g39750/T5I7.5 [Arabidopsis thaliana] gi|330254624|gb|AEC09718.1| putative methyltransferase PMT11 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449465844|ref|XP_004150637.1| PREDICTED: probable methyltransferase PMT11-like [Cucumis sativus] gi|449516433|ref|XP_004165251.1| PREDICTED: probable methyltransferase PMT11-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297806625|ref|XP_002871196.1| hypothetical protein ARALYDRAFT_487406 [Arabidopsis lyrata subsp. lyrata] gi|297317033|gb|EFH47455.1| hypothetical protein ARALYDRAFT_487406 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15239326|ref|NP_196224.1| putative methyltransferase PMT12 [Arabidopsis thaliana] gi|75262411|sp|Q9FG39.1|PMTC_ARATH RecName: Full=Probable methyltransferase PMT12 gi|10257485|dbj|BAB10206.1| ankyrin-like protein [Arabidopsis thaliana] gi|51536506|gb|AAU05491.1| At5g06050 [Arabidopsis thaliana] gi|58652086|gb|AAW80868.1| At5g06050 [Arabidopsis thaliana] gi|110740549|dbj|BAE98380.1| ankyrin like protein [Arabidopsis thaliana] gi|332003576|gb|AED90959.1| putative methyltransferase PMT12 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356553821|ref|XP_003545250.1| PREDICTED: probable methyltransferase PMT11-like [Glycine max] Back     alignment and taxonomy information
>gi|356499127|ref|XP_003518394.1| PREDICTED: probable methyltransferase PMT11-like [Glycine max] Back     alignment and taxonomy information
>gi|449476436|ref|XP_004154736.1| PREDICTED: probable methyltransferase PMT11-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query402
TAIR|locus:2063947694 AT2G39750 [Arabidopsis thalian 0.987 0.572 0.783 1.8e-174
TAIR|locus:2153704682 AT5G06050 [Arabidopsis thalian 0.962 0.567 0.790 2.4e-172
TAIR|locus:2195955655 AT1G77260 [Arabidopsis thalian 0.965 0.592 0.742 2.6e-166
TAIR|locus:2018329623 AT1G04430 [Arabidopsis thalian 0.902 0.582 0.478 6.3e-92
TAIR|locus:2090935611 AT3G23300 [Arabidopsis thalian 0.950 0.625 0.463 8.1e-92
TAIR|locus:2040864770 AT2G34300 [Arabidopsis thalian 0.932 0.487 0.466 1.7e-91
TAIR|locus:2129660608 AT4G14360 [Arabidopsis thalian 0.890 0.588 0.474 2.1e-91
TAIR|locus:2080823895 AT3G51070 [Arabidopsis thalian 0.932 0.418 0.463 5.7e-91
TAIR|locus:2160806829 AT5G64030 [Arabidopsis thalian 0.932 0.452 0.460 2.5e-90
TAIR|locus:2013628770 AT1G29470 [Arabidopsis thalian 0.935 0.488 0.465 8.3e-90
TAIR|locus:2063947 AT2G39750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1695 (601.7 bits), Expect = 1.8e-174, P = 1.8e-174
 Identities = 311/397 (78%), Positives = 343/397 (86%)

Query:     6 TWIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFAT 65
             T+ + +RV MD GCGVASFGAYLL R+V+TMS+APKDVHENQIQFALERG PAM AAFAT
Sbjct:   298 TFGKHIRVAMDVGCGVASFGAYLLSRDVMTMSVAPKDVHENQIQFALERGVPAMAAAFAT 357

Query:    66 RRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEH 125
             RRL YPSQAFDLIHCSRCRINWTRDDGILLLE+NRMLRAGGYFAWAAQPVYKHE A EE 
Sbjct:   358 RRLLYPSQAFDLIHCSRCRINWTRDDGILLLEINRMLRAGGYFAWAAQPVYKHEPALEEQ 417

Query:   126 WKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIXXXXXXXXXXXXVWYVDL 185
             W EML+LT  LCW+LVKKEGY+AIW+KP NN CYL+REAGT             VWY +L
Sbjct:   418 WTEMLNLTISLCWKLVKKEGYVAIWQKPFNNDCYLSREAGTKPPLCDESDDPDNVWYTNL 477

Query:   186 KACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYV 245
             K CI+R+PE GYG NV LWP RL T PDRLQ+I+ D++IARKELFKAESKYWNEII  YV
Sbjct:   478 KPCISRIPEKGYGGNVPLWPARLHTPPDRLQTIKFDSYIARKELFKAESKYWNEIIGGYV 537

Query:   246 RALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVM 305
             RAL WKKMKLRNVLDMRAGFGGFAAAL + K DCWV++VVPVSG NTLPVIYDRGL+GVM
Sbjct:   538 RALKWKKMKLRNVLDMRAGFGGFAAALNDHKLDCWVLSVVPVSGPNTLPVIYDRGLLGVM 597

Query:   306 HDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDE 365
             HDWCEPFDTYPRTYD LHA+GLFS+E KRC MSTI+LEMDR+LRPGG  YIRDSIDVMDE
Sbjct:   598 HDWCEPFDTYPRTYDFLHASGLFSIERKRCEMSTILLEMDRILRPGGRAYIRDSIDVMDE 657

Query:   366 LQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA 402
             +QEI KAMGWH +LR+T+EGPHASYRILT +KRLL A
Sbjct:   658 IQEITKAMGWHTSLRDTSEGPHASYRILTCEKRLLRA 694
GO:0005794 "Golgi apparatus" evidence=ISM;IDA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2153704 AT5G06050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195955 AT1G77260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018329 AT1G04430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090935 AT3G23300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040864 AT2G34300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129660 AT4G14360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080823 AT3G51070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160806 AT5G64030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013628 AT1G29470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22285PMTB_ARATH2, ., 1, ., 1, ., -0.80600.98750.5720yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query402
pfam03141506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 0.0
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 3e-08
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase doma 6e-06
pfam03141 506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 9e-06
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 0.002
>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information 
 Score =  662 bits (1710), Expect = 0.0
 Identities = 230/393 (58%), Positives = 276/393 (70%), Gaps = 10/393 (2%)

Query: 11  LRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPY 70
           +R  +D GCGVASFGAYLL R+V+TMS APKDVHE Q+QFALERG PAM+    TRRLPY
Sbjct: 118 VRTALDVGCGVASFGAYLLSRDVLTMSFAPKDVHEAQVQFALERGVPAMLGVLGTRRLPY 177

Query: 71  PSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVY-KHEEAQEEHWKEM 129
           PS++FD+ HCSRC I W  +DGILLLEV+R+LR GGYF  +  PVY + EE  +E WK M
Sbjct: 178 PSRSFDMAHCSRCLIPWHANDGILLLEVDRVLRPGGYFVLSGPPVYARDEEDLQEEWKAM 237

Query: 130 LDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACI 189
             L   LCW+LV K+G IAIW+KP NNSCY  RE G  PPLC   D+PD  WYV ++ACI
Sbjct: 238 EALAKSLCWKLVAKKGDIAIWQKPVNNSCYNKREPGKKPPLCKDSDDPDAAWYVPMEACI 297

Query: 190 TRLPEN---GYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVR 246
           T LPE      G  +  WPERL   P RL S Q        E FKA+++ W   +  Y R
Sbjct: 298 TPLPEVSHEVGGGWLEKWPERLTAVPPRLASGQ--IGGVSAEAFKADTELWKRRVSKYKR 355

Query: 247 ALH--WKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGV 304
            L     K ++RNV+DM AGFGGFAAALI+     WVMNVVPV   +TLPVIYDRGLIG+
Sbjct: 356 LLKLLIDKGRVRNVMDMNAGFGGFAAALIDDP--VWVMNVVPVDSPDTLPVIYDRGLIGI 413

Query: 305 MHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMD 364
            HDWCEPF TYPRTYDLLHA  LFS+  KRCN+  I+LEMDR+LRPGG V IRD +DV+D
Sbjct: 414 YHDWCEPFSTYPRTYDLLHADHLFSLYKKRCNLEDILLEMDRILRPGGAVIIRDDVDVLD 473

Query: 365 ELQEIGKAMGWHVTLRETAEGPHASYRILTADK 397
           ++++I KAM W V + +T +GPH   +IL A K
Sbjct: 474 KVKKIAKAMRWEVRITDTEDGPHDPEKILIAQK 506

This family is a putative S-adenosyl-L-methionine (SAM)-dependent methyltransferase. Length = 506
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 402
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 100.0
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 99.96
PLN02336475 phosphoethanolamine N-methyltransferase 99.92
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.71
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.65
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.65
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.64
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.62
KOG2940325 consensus Predicted methyltransferase [General fun 99.59
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.57
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.55
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.51
PLN02233261 ubiquinone biosynthesis methyltransferase 99.5
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.48
PLN02244340 tocopherol O-methyltransferase 99.47
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.46
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.45
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.45
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.45
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.44
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.43
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.41
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.41
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.41
PLN02233261 ubiquinone biosynthesis methyltransferase 99.4
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.4
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.4
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.39
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.39
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.39
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.39
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.38
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.38
PRK05785226 hypothetical protein; Provisional 99.38
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.37
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.37
PRK11207197 tellurite resistance protein TehB; Provisional 99.37
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.37
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.35
PLN02244340 tocopherol O-methyltransferase 99.35
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.32
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.32
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.32
TIGR00452314 methyltransferase, putative. Known examples to dat 99.32
PLN02336475 phosphoethanolamine N-methyltransferase 99.31
PRK11207197 tellurite resistance protein TehB; Provisional 99.31
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.31
KOG4300252 consensus Predicted methyltransferase [General fun 99.31
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.3
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.3
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.3
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.29
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.29
PLN02490340 MPBQ/MSBQ methyltransferase 99.29
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.28
PRK12335287 tellurite resistance protein TehB; Provisional 99.28
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.28
PRK05785226 hypothetical protein; Provisional 99.27
TIGR00452314 methyltransferase, putative. Known examples to dat 99.26
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.26
PRK12335287 tellurite resistance protein TehB; Provisional 99.26
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.25
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.24
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.24
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.23
PRK06922677 hypothetical protein; Provisional 99.23
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.21
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.21
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.21
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.21
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.2
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.2
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.19
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.19
PRK08317241 hypothetical protein; Provisional 99.19
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.18
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.17
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.17
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.16
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.16
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.16
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.16
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.15
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.15
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.14
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.14
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.13
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.13
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.13
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.13
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.13
PLN02490340 MPBQ/MSBQ methyltransferase 99.12
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.12
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.12
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.12
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.11
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.11
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.11
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.1
KOG4300252 consensus Predicted methyltransferase [General fun 99.09
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.08
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.08
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.08
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.07
PRK06922677 hypothetical protein; Provisional 99.07
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.07
PRK14967223 putative methyltransferase; Provisional 99.07
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.07
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.06
PRK08317241 hypothetical protein; Provisional 99.06
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.06
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.06
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.05
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.05
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.05
PRK06202232 hypothetical protein; Provisional 99.04
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.04
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.03
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.03
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.03
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.02
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.02
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.01
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.01
COG4976287 Predicted methyltransferase (contains TPR repeat) 99.01
PRK06202232 hypothetical protein; Provisional 99.01
KOG1271227 consensus Methyltransferases [General function pre 98.99
TIGR00438188 rrmJ cell division protein FtsJ. 98.99
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.99
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.98
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.98
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.98
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.97
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.97
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.97
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.97
PLN03075296 nicotianamine synthase; Provisional 98.96
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.96
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.96
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.95
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.94
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.94
KOG3010261 consensus Methyltransferase [General function pred 98.94
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.94
PRK14968188 putative methyltransferase; Provisional 98.93
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.92
PRK04266226 fibrillarin; Provisional 98.92
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.92
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.92
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.92
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.92
COG4123248 Predicted O-methyltransferase [General function pr 98.92
PRK04266226 fibrillarin; Provisional 98.92
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.91
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.91
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.9
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.9
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.9
PRK14968188 putative methyltransferase; Provisional 98.9
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.89
COG4106257 Tam Trans-aconitate methyltransferase [General fun 98.88
TIGR03438301 probable methyltransferase. This model represents 98.88
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.88
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.88
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.87
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.87
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.86
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.86
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 98.85
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.85
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.85
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.85
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.83
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.83
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.82
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.82
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.82
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.82
PTZ00146293 fibrillarin; Provisional 98.81
TIGR00438188 rrmJ cell division protein FtsJ. 98.81
KOG2361264 consensus Predicted methyltransferase [General fun 98.79
PLN03075296 nicotianamine synthase; Provisional 98.79
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.79
PRK07402196 precorrin-6B methylase; Provisional 98.78
PHA03411279 putative methyltransferase; Provisional 98.78
PTZ00146293 fibrillarin; Provisional 98.77
KOG3010261 consensus Methyltransferase [General function pred 98.77
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.75
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.75
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.75
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.75
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.75
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.73
PRK10901427 16S rRNA methyltransferase B; Provisional 98.73
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.73
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.72
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.72
PLN02232160 ubiquinone biosynthesis methyltransferase 98.71
COG2890280 HemK Methylase of polypeptide chain release factor 98.69
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.69
TIGR03438301 probable methyltransferase. This model represents 98.68
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.68
PRK00811283 spermidine synthase; Provisional 98.68
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.67
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.67
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.65
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.65
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.64
PRK14967223 putative methyltransferase; Provisional 98.63
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.62
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.61
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.61
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.6
PRK07402196 precorrin-6B methylase; Provisional 98.6
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.58
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.58
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.56
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.56
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.56
PRK14904445 16S rRNA methyltransferase B; Provisional 98.56
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.56
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.55
PRK14901434 16S rRNA methyltransferase B; Provisional 98.55
PRK14903431 16S rRNA methyltransferase B; Provisional 98.55
PRK04457262 spermidine synthase; Provisional 98.54
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.54
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.54
PHA03412241 putative methyltransferase; Provisional 98.54
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.53
PLN02232160 ubiquinone biosynthesis methyltransferase 98.52
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.52
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 98.52
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.52
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.52
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.5
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.5
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.5
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.5
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.49
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.47
COG2890280 HemK Methylase of polypeptide chain release factor 98.45
KOG2361264 consensus Predicted methyltransferase [General fun 98.45
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.45
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.44
PRK14902444 16S rRNA methyltransferase B; Provisional 98.42
PRK01581374 speE spermidine synthase; Validated 98.42
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.42
COG4123248 Predicted O-methyltransferase [General function pr 98.4
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.39
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 98.38
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.37
PLN02366308 spermidine synthase 98.37
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.36
PRK04457262 spermidine synthase; Provisional 98.36
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.34
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.34
PRK03612521 spermidine synthase; Provisional 98.33
KOG2899288 consensus Predicted methyltransferase [General fun 98.32
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.32
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.3
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.3
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.29
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.28
PRK00811283 spermidine synthase; Provisional 98.26
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.26
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.26
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.24
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.24
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.22
KOG1271227 consensus Methyltransferases [General function pre 98.22
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.22
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.21
PRK14903431 16S rRNA methyltransferase B; Provisional 98.21
PRK01581374 speE spermidine synthase; Validated 98.21
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.19
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.18
PRK14901434 16S rRNA methyltransferase B; Provisional 98.18
KOG2904328 consensus Predicted methyltransferase [General fun 98.18
PRK14904445 16S rRNA methyltransferase B; Provisional 98.17
PRK10901427 16S rRNA methyltransferase B; Provisional 98.17
PLN02672 1082 methionine S-methyltransferase 98.16
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.16
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.13
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.12
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.12
KOG1499346 consensus Protein arginine N-methyltransferase PRM 98.08
KOG1269 364 consensus SAM-dependent methyltransferases [Lipid 98.08
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.08
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.08
PRK14902444 16S rRNA methyltransferase B; Provisional 98.06
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.04
PHA03411279 putative methyltransferase; Provisional 98.02
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.0
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 97.99
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 97.99
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 97.99
COG4122219 Predicted O-methyltransferase [General function pr 97.98
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 97.96
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 97.95
COG1041347 Predicted DNA modification methylase [DNA replicat 97.93
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 97.93
KOG2940 325 consensus Predicted methyltransferase [General fun 97.92
COG2263198 Predicted RNA methylase [Translation, ribosomal st 97.91
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 97.9
PRK03612521 spermidine synthase; Provisional 97.9
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 97.85
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 97.85
PLN02366308 spermidine synthase 97.85
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.85
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.84
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 97.84
PLN02476278 O-methyltransferase 97.84
KOG1331293 consensus Predicted methyltransferase [General fun 97.83
COG2521287 Predicted archaeal methyltransferase [General func 97.82
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.82
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 97.8
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.78
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 97.78
COG2521287 Predicted archaeal methyltransferase [General func 97.77
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.76
smart00650169 rADc Ribosomal RNA adenine dimethylases. 97.75
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 97.75
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.75
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.74
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 97.73
PLN02476278 O-methyltransferase 97.73
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 97.71
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 97.7
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 97.69
PHA03412241 putative methyltransferase; Provisional 97.69
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 97.69
PRK04148134 hypothetical protein; Provisional 97.68
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.68
PLN02823336 spermine synthase 97.68
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 97.67
PRK00536262 speE spermidine synthase; Provisional 97.67
KOG1331 293 consensus Predicted methyltransferase [General fun 97.66
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.66
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.62
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.57
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 97.57
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.57
PTZ00338294 dimethyladenosine transferase-like protein; Provis 97.56
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.56
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.55
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 97.54
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 97.54
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.53
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.53
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.53
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.5
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 97.49
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 97.48
PLN02589247 caffeoyl-CoA O-methyltransferase 97.46
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 97.44
PRK04148134 hypothetical protein; Provisional 97.44
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.43
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 97.43
KOG2352482 consensus Predicted spermine/spermidine synthase [ 97.43
COG4122219 Predicted O-methyltransferase [General function pr 97.42
KOG3987288 consensus Uncharacterized conserved protein DREV/C 97.4
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.4
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 97.38
COG4627185 Uncharacterized protein conserved in bacteria [Fun 97.36
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.34
PLN02672 1082 methionine S-methyltransferase 97.34
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.34
KOG2904328 consensus Predicted methyltransferase [General fun 97.32
KOG2899288 consensus Predicted methyltransferase [General fun 97.31
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 97.28
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.27
KOG1500517 consensus Protein arginine N-methyltransferase CAR 97.22
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.22
COG1092393 Predicted SAM-dependent methyltransferases [Genera 97.21
KOG3420185 consensus Predicted RNA methylase [Translation, ri 97.2
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.19
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 97.18
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.16
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.16
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.13
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.11
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 97.07
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.05
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.03
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 96.99
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.92
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 96.9
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 96.85
TIGR02987524 met_A_Alw26 type II restriction m6 adenine DNA met 96.83
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 96.83
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 96.83
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.82
COG3897218 Predicted methyltransferase [General function pred 96.78
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 96.77
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 96.72
PLN02823336 spermine synthase 96.72
KOG1663237 consensus O-methyltransferase [Secondary metabolit 96.71
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.71
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.64
COG0742187 N6-adenine-specific methylase [DNA replication, re 96.62
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 96.62
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 96.62
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 96.6
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 96.6
COG2265432 TrmA SAM-dependent methyltransferases related to t 96.54
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 96.53
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.51
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 96.5
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 96.49
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 96.46
KOG1709271 consensus Guanidinoacetate methyltransferase and r 96.4
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 96.4
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 96.36
COG4627185 Uncharacterized protein conserved in bacteria [Fun 96.3
KOG1663237 consensus O-methyltransferase [Secondary metabolit 96.28
PRK00536262 speE spermidine synthase; Provisional 96.25
PLN02589247 caffeoyl-CoA O-methyltransferase 96.22
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 96.14
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 96.13
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 96.07
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 96.02
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.01
COG1092393 Predicted SAM-dependent methyltransferases [Genera 96.0
COG2520341 Predicted methyltransferase [General function pred 95.96
KOG3987288 consensus Uncharacterized conserved protein DREV/C 95.96
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 95.92
COG2263198 Predicted RNA methylase [Translation, ribosomal st 95.92
PF03269177 DUF268: Caenorhabditis protein of unknown function 95.91
KOG1709271 consensus Guanidinoacetate methyltransferase and r 95.86
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 95.86
PF13679141 Methyltransf_32: Methyltransferase domain 95.83
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 95.81
KOG3115249 consensus Methyltransferase-like protein [General 95.74
COG1041347 Predicted DNA modification methylase [DNA replicat 95.66
PLN02668386 indole-3-acetate carboxyl methyltransferase 95.65
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 95.62
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 95.6
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 95.57
COG0421282 SpeE Spermidine synthase [Amino acid transport and 95.56
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 95.54
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 95.5
COG4798238 Predicted methyltransferase [General function pred 95.47
COG4798238 Predicted methyltransferase [General function pred 95.45
KOG3201201 consensus Uncharacterized conserved protein [Funct 95.21
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 95.18
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 95.14
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 95.11
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 95.06
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 94.95
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 94.95
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 94.87
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 94.85
KOG2352 482 consensus Predicted spermine/spermidine synthase [ 94.84
PF03492334 Methyltransf_7: SAM dependent carboxyl methyltrans 94.82
KOG3201201 consensus Uncharacterized conserved protein [Funct 94.82
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 94.78
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 94.77
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 94.75
COG4076252 Predicted RNA methylase [General function predicti 94.74
PLN02668 386 indole-3-acetate carboxyl methyltransferase 94.73
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 94.72
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 94.66
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 94.54
KOG3115249 consensus Methyltransferase-like protein [General 94.53
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 94.48
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 94.43
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 94.33
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 94.04
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 93.97
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 93.94
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 93.92
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 93.84
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 93.83
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 93.78
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 93.61
COG5459484 Predicted rRNA methylase [Translation, ribosomal s 93.58
PRK13699 227 putative methylase; Provisional 93.57
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 93.52
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 93.49
COG2265432 TrmA SAM-dependent methyltransferases related to t 93.42
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 93.21
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 92.69
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 92.61
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 92.57
COG4262508 Predicted spermidine synthase with an N-terminal m 92.56
COG3897218 Predicted methyltransferase [General function pred 92.52
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 92.34
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 92.3
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 91.84
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 91.71
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 91.66
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 91.6
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 91.57
PF13679141 Methyltransf_32: Methyltransferase domain 91.01
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 90.25
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 89.78
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 89.77
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 89.42
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 89.17
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 89.17
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information 
Probab=100.00  E-value=5.9e-87  Score=649.32  Aligned_cols=387  Identities=57%  Similarity=1.072  Sum_probs=364.5

Q ss_pred             cCCCCCeEEEECCccchhHHHHccCCceEEeCCccchHHHHHHHHHHcCCCcEEEeccccCCCCCCCCeeEEEecCcccc
Q 015704            7 WIRLLRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRIN   86 (402)
Q Consensus         7 ~~~~~~~VLDiGcG~G~~~~~L~~~~v~~vdi~~~~~~~a~~~~a~~~~~~~~~~~~d~~~lp~~~~sfDlI~s~~~~~~   86 (402)
                      .++..+.+||+|||+|+|+.+|.+++|+.+.+++.+.++++.++|.++|++..+.......|||++++||+|+|+.+...
T Consensus       114 ~~g~iR~~LDvGcG~aSF~a~l~~r~V~t~s~a~~d~~~~qvqfaleRGvpa~~~~~~s~rLPfp~~~fDmvHcsrc~i~  193 (506)
T PF03141_consen  114 WGGGIRTALDVGCGVASFGAYLLERNVTTMSFAPNDEHEAQVQFALERGVPAMIGVLGSQRLPFPSNAFDMVHCSRCLIP  193 (506)
T ss_pred             cCCceEEEEeccceeehhHHHHhhCCceEEEcccccCCchhhhhhhhcCcchhhhhhccccccCCccchhhhhccccccc
Confidence            44566789999999999999999999999999999999999999999999888777667899999999999999999999


Q ss_pred             cccChHHHHHHHHHhcCCCeEEEEEeCCCC-CChHHHHHHHHHHHhhhhhcceeeeeccceEEEeecCCChhhhhhhhcC
Q 015704           87 WTRDDGILLLEVNRMLRAGGYFAWAAQPVY-KHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAG  165 (402)
Q Consensus        87 ~~~d~~~~l~e~~r~LkpgG~li~~~~~~~-~~~~el~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aG  165 (402)
                      |..+...+|-++.|+|||||+|+++.+|.+ .+..++.+.|..++++++.+||+.+.+.+.+.+|+||..+.|+..++.+
T Consensus       194 W~~~~g~~l~evdRvLRpGGyfv~S~ppv~~r~~~~~~~~~~~~~~l~~~lCW~~va~~~~~aIwqKp~~~~Cy~~r~~~  273 (506)
T PF03141_consen  194 WHPNDGFLLFEVDRVLRPGGYFVLSGPPVYQRTDEDLEEEWNAMEDLAKSLCWKKVAEKGDTAIWQKPTNNSCYQKRKPG  273 (506)
T ss_pred             chhcccceeehhhhhhccCceEEecCCcccccchHHHHHHHHHHHHHHHHHHHHHheeeCCEEEEeccCCchhhhhccCC
Confidence            998878899999999999999999998888 6777899999999999999999999999999999999999999998888


Q ss_pred             CCCCCCCCCCCCCCcccccccceeecCCCC---CCCCCCCCCCcccCCCCcccccccccccccchhhhHHhhHHHHHHHH
Q 015704          166 TIPPLCDPDDNPDNVWYVDLKACITRLPEN---GYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIE  242 (402)
Q Consensus       166 f~~~~~~~~~~~~~~~y~~~~~~l~~l~~~---ga~~~~~~Wp~rl~~~~~rl~~~~~~~~~~~~~~~~~~~~~w~~~~~  242 (402)
                      -.|++|...++++..||.++++||+.++..   .++.++.+||+||..+|+|++......  .+.+.|.+|+++|+.+++
T Consensus       274 ~~pplC~~~~dpd~aWY~~l~~Cit~~p~~~~~~~~~~~~~WP~RL~~~P~rl~~~~~~g--~~~e~F~~Dt~~Wk~~V~  351 (506)
T PF03141_consen  274 KSPPLCDSSDDPDAAWYVPLEACITPLPEVSSEIAGGWLPKWPERLNAVPPRLSSGSIPG--ISPEEFKEDTKHWKKRVS  351 (506)
T ss_pred             CCCCCCCCCCCCcchhhcchhhhcCcCCcccccccccCCCCChhhhccCchhhhcCCcCC--CCHHHHHHHHHHHHHHHH
Confidence            899999988999999999999999999875   466789999999999999999855332  356999999999999999


Q ss_pred             HHHHhcc--cCCCCcceEEeccccchHHHHHHhhcCCCceEEEeccCCCCCChhhHHhcCcccccccCCCCCCCCCCccc
Q 015704          243 SYVRALH--WKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYD  320 (402)
Q Consensus       243 ~y~~~~~--~~~~~~~~vLD~g~g~G~~~~~l~~~~~~~~~~~v~~~~~~~~~~~~~~rg~~~~~~~~~~~~~~~~~sfD  320 (402)
                      .|++.++  +.++++||||||++|+|||||+|.++  +||||||+|...++++.++++|||||++|+|||+|+|||+|||
T Consensus       352 ~Y~~l~~~~i~~~~iRNVMDMnAg~GGFAAAL~~~--~VWVMNVVP~~~~ntL~vIydRGLIG~yhDWCE~fsTYPRTYD  429 (506)
T PF03141_consen  352 HYKKLLGLAIKWGRIRNVMDMNAGYGGFAAALIDD--PVWVMNVVPVSGPNTLPVIYDRGLIGVYHDWCEAFSTYPRTYD  429 (506)
T ss_pred             HHHHhhcccccccceeeeeeecccccHHHHHhccC--CceEEEecccCCCCcchhhhhcccchhccchhhccCCCCcchh
Confidence            9998877  78999999999999999999999998  4799999999999999999999999999999999999999999


Q ss_pred             EEEEccccccccccCCHHHHHHHhhhhccCCcEEEEEeChhhHHHHHHHHHhcCceEEEeecCCCCCCceEEEEEEe
Q 015704          321 LLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADK  397 (402)
Q Consensus       321 ~v~~~~~~~~~~~~~~~~~~l~e~~RvLrpgG~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~l~~~k  397 (402)
                      +||++++|+++.++|+++++|.||||||||||++||||..+++.++++++++|||++.++++|+++.++||+|+|+|
T Consensus       430 LlHA~~lfs~~~~rC~~~~illEmDRILRP~G~~iiRD~~~vl~~v~~i~~~lrW~~~~~d~e~g~~~~EkiL~~~K  506 (506)
T PF03141_consen  430 LLHADGLFSLYKDRCEMEDILLEMDRILRPGGWVIIRDTVDVLEKVKKIAKSLRWEVRIHDTEDGPDGPEKILICQK  506 (506)
T ss_pred             heehhhhhhhhcccccHHHHHHHhHhhcCCCceEEEeccHHHHHHHHHHHHhCcceEEEEecCCCCCCCceEEEEEC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999998

; GO: 0008168 methyltransferase activity
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query402
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 7e-07
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 2e-06
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 2e-06
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 4e-06
3i9f_A170 Putative type 11 methyltransferase; structural gen 1e-05
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 2e-05
3ege_A261 Putative methyltransferase from antibiotic biosyn 3e-05
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 3e-05
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 4e-05
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 1e-04
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 1e-04
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 2e-04
3f4k_A257 Putative methyltransferase; structural genomics, P 3e-04
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 4e-04
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 4e-04
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 4e-04
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 5e-04
3cc8_A230 Putative methyltransferase; structural genomics, j 5e-04
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 5e-04
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
 Score = 49.1 bits (117), Expect = 7e-07
 Identities = 23/130 (17%), Positives = 45/130 (34%), Gaps = 21/130 (16%)

Query: 12  RVVMDAGCGVASFGAYLL---PRNVITMSIAPKDVHENQIQFALERGAPAMVAAFA--TR 66
           + V+D GCG      Y      + V+ +     D+ E  +  A  +    +V        
Sbjct: 46  KTVLDLGCGFGWHCIYAAEHGAKKVLGI-----DLSERMLTEAKRKTTSPVVCYEQKAIE 100

Query: 67  RLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYF----------AWAAQPVY 116
            +     A++++  S   +++      +  +V   L++ G F          A   Q  Y
Sbjct: 101 DIAIEPDAYNVVLSSLA-LHYIASFDDICKKVYINLKSSGSFIFSVEHPVFTADGRQDWY 159

Query: 117 KHEEAQEEHW 126
             E   + HW
Sbjct: 160 TDETGNKLHW 169
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query402
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.59
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.59
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.56
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.56
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.55
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.54
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.52
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.51
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.5
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.49
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.48
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.48
3f4k_A257 Putative methyltransferase; structural genomics, P 99.48
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.48
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.48
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.47
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.47
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.46
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.46
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.46
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.46
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.45
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.45
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.45
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.45
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.45
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.44
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.44
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.44
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.44
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.43
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.43
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.43
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.43
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.43
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.43
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.43
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.42
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.42
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.42
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.42
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.42
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.42
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.41
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.41
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.41
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.41
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.41
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.4
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.4
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.4
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.4
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.4
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.4
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.4
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.4
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.4
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.4
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.39
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.39
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.39
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.39
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.39
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.38
3lcc_A235 Putative methyl chloride transferase; halide methy 99.38
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.38
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.38
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.38
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.37
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.37
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.37
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.37
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.36
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.36
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.36
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.36
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.36
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.36
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.36
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.36
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.36
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.35
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.35
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.35
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.35
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.35
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.35
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.35
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.35
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.35
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.35
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.35
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.35
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.35
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.34
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.34
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.34
3cc8_A230 Putative methyltransferase; structural genomics, j 99.34
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.34
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.34
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.34
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.34
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.34
3ocj_A305 Putative exported protein; structural genomics, PS 99.33
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.33
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.33
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.33
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.33
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.33
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.33
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.33
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.33
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.32
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.32
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.32
3lcc_A235 Putative methyl chloride transferase; halide methy 99.32
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.32
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.32
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.32
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.31
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.31
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.31
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.31
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.3
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.3
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.3
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.3
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.29
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.29
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.29
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.29
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.29
3ocj_A305 Putative exported protein; structural genomics, PS 99.29
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.29
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.29
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.29
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.29
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.28
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.28
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.28
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 99.28
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.27
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.27
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.27
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.27
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.27
3cc8_A230 Putative methyltransferase; structural genomics, j 99.27
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.26
3f4k_A257 Putative methyltransferase; structural genomics, P 99.26
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.26
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.26
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.26
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.25
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.25
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 99.25
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.25
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.25
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.25
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.24
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.24
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.23
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.23
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.23
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.23
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.23
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.23
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.22
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.22
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.22
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.22
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.22
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.21
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.21
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.21
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.21
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.21
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.2
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.2
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.2
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.2
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 99.2
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.2
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.19
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.19
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.19
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.18
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.18
3lpm_A259 Putative methyltransferase; structural genomics, p 99.18
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.18
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.17
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.17
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.17
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.16
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.16
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.16
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.15
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.15
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.15
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.15
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.15
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.15
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.15
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.15
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.15
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.15
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.15
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.14
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.14
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.14
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.14
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.13
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.13
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.13
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.13
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.12
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.12
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.12
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.12
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.11
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.11
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.11
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.11
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.11
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.1
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.1
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.1
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.1
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.1
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.1
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.1
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.09
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.09
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.09
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.08
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.08
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.08
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.08
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.08
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.08
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.08
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.08
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.07
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.07
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.07
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.07
3lpm_A259 Putative methyltransferase; structural genomics, p 99.07
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.07
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 99.07
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.07
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.07
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.06
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.06
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.06
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.06
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.06
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.06
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.06
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.05
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.05
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.05
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.05
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.05
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.04
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.04
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.04
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.04
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.04
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.04
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.03
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.03
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.03
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.03
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.03
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.03
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.03
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.03
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.02
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.02
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.02
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.02
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.02
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.02
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.02
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.02
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.02
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.02
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 99.01
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.01
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.01
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.01
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.0
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.0
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.0
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.0
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.0
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.0
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.99
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.99
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.99
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.99
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 98.99
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.99
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.99
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.99
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 98.99
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.99
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.98
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.98
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.98
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.98
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.98
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.97
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.97
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.97
2b25_A336 Hypothetical protein; structural genomics, methyl 98.97
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.96
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.96
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.96
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.96
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.96
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 98.95
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.95
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.95
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.95
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.95
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.95
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.94
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.94
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.93
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.93
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.93
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.92
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.92
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.92
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.92
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.92
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.91
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.91
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.91
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.91
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.91
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.91
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.91
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.91
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.91
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.91
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.91
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.9
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.9
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.9
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.9
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 98.9
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.9
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.89
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.89
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.89
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.89
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.89
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.88
2pt6_A321 Spermidine synthase; transferase, structural genom 98.88
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.87
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.87
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.87
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.87
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.87
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.87
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.86
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.86
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.86
1ws6_A171 Methyltransferase; structural genomics, riken stru 98.86
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.86
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.86
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.85
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.85
2i7c_A283 Spermidine synthase; transferase, structural genom 98.85
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.85
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.85
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.85
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.84
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.84
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.84
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.84
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.84
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.83
2o07_A304 Spermidine synthase; structural genomics, structur 98.83
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.83
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.83
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.82
2h00_A254 Methyltransferase 10 domain containing protein; st 98.82
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.82
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.82
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.81
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.81
2b25_A336 Hypothetical protein; structural genomics, methyl 98.81
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.81
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.8
2fpo_A202 Methylase YHHF; structural genomics, putative meth 98.8
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.8
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.8
2esr_A177 Methyltransferase; structural genomics, hypothetic 98.8
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.8
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.8
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.8
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.79
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.79
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.79
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.78
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.78
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.78
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.78
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.78
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.77
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.77
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.77
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.77
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.77
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.76
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.76
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.76
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.76
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.76
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.76
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.75
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.75
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.75
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.74
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.74
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.73
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 98.71
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.71
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.71
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.71
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.7
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.69
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.67
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.67
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.67
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.67
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.67
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.67
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.67
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.67
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.66
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.65
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.64
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.64
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.64
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.63
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.63
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.62
2o07_A304 Spermidine synthase; structural genomics, structur 98.6
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.6
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.59
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.59
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.59
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.59
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.57
2h00_A254 Methyltransferase 10 domain containing protein; st 98.57
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.56
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.55
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.54
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.54
2pt6_A321 Spermidine synthase; transferase, structural genom 98.53
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.53
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.53
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.52
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.52
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.52
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.51
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.51
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.51
2i7c_A283 Spermidine synthase; transferase, structural genom 98.5
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.48
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.48
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.48
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.48
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.47
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.46
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.46
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.46
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.43
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 98.43
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.41
3k6r_A278 Putative transferase PH0793; structural genomics, 98.4
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.4
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.38
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 98.38
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.37
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.37
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.35
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.35
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.32
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.32
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.31
3k6r_A278 Putative transferase PH0793; structural genomics, 98.31
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.31
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.31
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.31
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 98.3
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.28
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
Probab=99.59  E-value=1.9e-15  Score=140.77  Aligned_cols=112  Identities=17%  Similarity=0.220  Sum_probs=86.3

Q ss_pred             cCCCCCeEEEECCccchhHHHHccC--CceEEeCCccchHHHHHHHHHHcCCCcEEEeccccCCCCCCCCeeEEEecCcc
Q 015704            7 WIRLLRVVMDAGCGVASFGAYLLPR--NVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCR   84 (402)
Q Consensus         7 ~~~~~~~VLDiGcG~G~~~~~L~~~--~v~~vdi~~~~~~~a~~~~a~~~~~~~~~~~~d~~~lp~~~~sfDlI~s~~~~   84 (402)
                      +.....+|||+|||+|.++..|++.  +|+++|+++.++     +.+++ .....+...+++++|+++++||+|+|+.+ 
T Consensus        36 ~~~~~~~vLDvGcGtG~~~~~l~~~~~~v~gvD~s~~ml-----~~a~~-~~~v~~~~~~~e~~~~~~~sfD~v~~~~~-  108 (257)
T 4hg2_A           36 VAPARGDALDCGCGSGQASLGLAEFFERVHAVDPGEAQI-----RQALR-HPRVTYAVAPAEDTGLPPASVDVAIAAQA-  108 (257)
T ss_dssp             HSSCSSEEEEESCTTTTTHHHHHTTCSEEEEEESCHHHH-----HTCCC-CTTEEEEECCTTCCCCCSSCEEEEEECSC-
T ss_pred             hcCCCCCEEEEcCCCCHHHHHHHHhCCEEEEEeCcHHhh-----hhhhh-cCCceeehhhhhhhcccCCcccEEEEeee-
Confidence            3445679999999999999999886  789999987655     33332 23455777889999999999999999877 


Q ss_pred             cccccChHHHHHHHHHhcCCCeEEEEEeCCCCCChHHHHHHH
Q 015704           85 INWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHW  126 (402)
Q Consensus        85 ~~~~~d~~~~l~e~~r~LkpgG~li~~~~~~~~~~~el~~~~  126 (402)
                      +||. ++..++++++|+|||||.|++.+.......+++....
T Consensus       109 ~h~~-~~~~~~~e~~rvLkpgG~l~~~~~~~~~~~~~~~~~~  149 (257)
T 4hg2_A          109 MHWF-DLDRFWAELRRVARPGAVFAAVTYGLTRVDPEVDAVV  149 (257)
T ss_dssp             CTTC-CHHHHHHHHHHHEEEEEEEEEEEECCCBCCHHHHHHH
T ss_pred             hhHh-hHHHHHHHHHHHcCCCCEEEEEECCCCCCCHHHHHHH
Confidence            5776 6889999999999999999988643333334444443
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 402
d2gh1a1 281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 7e-06
d1wzna1251 c.66.1.43 (A:1-251) Hypothetical methyltransferase 5e-05
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 0.001
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 0.002
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: BC2162-like
domain: Methyltransferase BC2162
species: Bacillus cereus [TaxId: 1396]

 Score = 44.9 bits (105), Expect = 7e-06
 Identities = 19/123 (15%), Positives = 41/123 (33%)

Query: 236 YWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPV 295
           Y+N+   S++    WK  K  +++D   G+G     L+    +      +          
Sbjct: 9   YYNDDYVSFLVNTVWKITKPVHIVDYGCGYGYLGLVLMPLLPEGSKYTGIDSGETLLAEA 68

Query: 296 IYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVY 355
                L+    ++ E   T     D    A   +         T++ +M   ++ GG + 
Sbjct: 69  RELFRLLPYDSEFLEGDATEIELNDKYDIAICHAFLLHMTTPETMLQKMIHSVKKGGKII 128

Query: 356 IRD 358
             +
Sbjct: 129 CFE 131
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query402
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.72
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.71
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.66
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.65
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.64
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.62
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.61
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.6
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.58
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.56
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.56
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.56
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.55
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.55
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.55
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.54
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.54
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.53
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.53
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.53
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.53
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.52
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.51
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.51
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.5
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.49
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.49
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.48
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.48
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.45
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.45
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.45
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.44
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.41
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.4
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.4
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.39
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.39
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.39
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.39
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.37
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.36
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.35
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.35
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.33
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.32
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.31
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.31
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.3
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.3
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.3
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.28
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.27
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.27
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.26
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.25
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.25
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.25
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.24
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.24
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.23
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.22
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.22
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.21
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.18
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.17
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.16
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.16
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.16
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.16
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.15
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.11
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.1
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.1
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.08
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.07
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.06
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.06
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.05
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.03
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.03
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.03
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.02
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.01
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.99
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.9
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.89
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.88
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.87
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.87
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.84
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.82
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.79
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.72
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.7
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.69
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.69
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.66
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.66
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.66
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.65
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.62
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.61
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.56
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.56
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.52
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.52
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.51
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.48
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.48
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.41
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.39
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.37
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.36
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.33
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.33
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.24
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.21
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.18
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.18
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.17
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.17
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.17
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.13
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.12
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.12
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.09
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.07
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.07
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.0
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.0
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.97
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 97.96
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 97.95
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 97.93
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.92
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 97.9
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.89
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 97.87
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 97.85
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.8
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 97.8
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.78
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.75
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 97.75
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.7
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 97.7
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 97.7
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.65
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.63
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.59
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.55
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.49
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.46
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.46
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.41
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.39
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 97.39
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.36
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.29
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 97.22
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.21
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 97.21
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.18
d2h00a1250 Methyltransferase 10 domain containing protein MET 97.18
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.15
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.12
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.08
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.05
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.04
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.03
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 96.98
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 96.78
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 96.72
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 96.5
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 96.42
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 96.4
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.14
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 95.91
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 95.85
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 95.77
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 95.77
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 95.68
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 95.66
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 95.63
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 95.46
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 95.27
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 94.89
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.85
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 94.84
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 94.71
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 94.63
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.52
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 94.47
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 94.41
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 94.08
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 94.0
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 93.36
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.32
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.02
d1m6ex_ 359 Salicylic acid carboxyl methyltransferase (SAMT) { 92.97
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 92.89
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.82
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.77
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 92.48
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.38
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.35
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.01
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 91.43
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.1
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 91.06
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 90.8
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 89.89
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 88.5
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 88.35
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 88.19
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 88.09
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 87.04
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 86.64
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 86.61
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 86.58
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 86.24
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 86.2
d2uyoa1297 Putative methyltransferase ML2640 {Mycobacterium l 85.42
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 85.24
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 84.97
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 84.82
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 84.48
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 83.36
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 82.09
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 81.96
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 81.2
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 80.42
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 80.06
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein BH2331
species: Bacillus halodurans [TaxId: 86665]

Probab=99.72  E-value=1.2e-17  Score=150.27  Aligned_cols=103  Identities=15%  Similarity=0.308  Sum_probs=84.6

Q ss_pred             CCCCeEEEECCccchhHHHHccC--CceEEeCCccchHHHHHHHHHHcCCC-cEEEeccccCCCCCCCCeeEEEecCccc
Q 015704            9 RLLRVVMDAGCGVASFGAYLLPR--NVITMSIAPKDVHENQIQFALERGAP-AMVAAFATRRLPYPSQAFDLIHCSRCRI   85 (402)
Q Consensus         9 ~~~~~VLDiGcG~G~~~~~L~~~--~v~~vdi~~~~~~~a~~~~a~~~~~~-~~~~~~d~~~lp~~~~sfDlI~s~~~~~   85 (402)
                      +++.+|||||||+|.++..+++.  +++++|+++.++..++ +.+...+.+ ..+.+.+.+.+|+++++||+|+|..+++
T Consensus        14 ~~~~rVLDiGcG~G~~~~~l~~~~~~v~gvD~s~~~i~~A~-~~~~~~~~~~i~~~~~d~~~l~~~~~~fD~v~~~~~l~   92 (231)
T d1vl5a_          14 KGNEEVLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVAR-AFIEGNGHQQVEYVQGDAEQMPFTDERFHIVTCRIAAH   92 (231)
T ss_dssp             CSCCEEEEETCTTCHHHHHHGGGSSEEEEEESCHHHHHHHH-HHHHHTTCCSEEEEECCC-CCCSCTTCEEEEEEESCGG
T ss_pred             CCcCEEEEecccCcHHHHHHHHhCCEEEEEECCHHHHhhhh-hccccccccccccccccccccccccccccccccccccc
Confidence            35689999999999999998876  7999999998887665 334444444 4477789999999999999999998755


Q ss_pred             ccccChHHHHHHHHHhcCCCeEEEEEeC
Q 015704           86 NWTRDDGILLLEVNRMLRAGGYFAWAAQ  113 (402)
Q Consensus        86 ~~~~d~~~~l~e~~r~LkpgG~li~~~~  113 (402)
                      |+ +|+..++++++++|||||++++.++
T Consensus        93 ~~-~d~~~~l~~~~r~LkpgG~l~i~~~  119 (231)
T d1vl5a_          93 HF-PNPASFVSEAYRVLKKGGQLLLVDN  119 (231)
T ss_dssp             GC-SCHHHHHHHHHHHEEEEEEEEEEEE
T ss_pred             cc-CCHHHHHHHHHHhcCCCcEEEEEeC
Confidence            54 5899999999999999999999753
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure