Citrus Sinensis ID: 015732


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-
MRFSESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGSPFGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRKQQAAQEAYDEDDDMQGGAQRVQCAQQ
cEECcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHcHHHHcccccccccccccccHHHHcccccccccccccccccccccEEEEEEEcHHHHHcccEEEEEEEEEEEccccccccccccccccccccccccEEEEEEECccccEEEEEECccccccCEEEEccccccccccccEEEEEEEEEEEEEccccccccEEEEccccccccccccccEEEEEEEccccccEECcccEEEEEEccHHHHccccEEEEEcccccEEEEEEccccccccccEEEEccccccccccccccccEEEEEEEEccccccHHHHHHHHHHccccccccccccccccCEEEEcccccHHHHHHHHHHHHcccccccccccccccccccccc
*RFSESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYG*******************IFQSF*********************IHPLKVSLEDLYNGTSKKLSLSRNVICTKCKG**********CSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGE****PDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVL***************CEETTL**************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFSESRKNASQDDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGAHDPFDIFQSFFGGSPFGGSSRGRRQRRGEDVIHPLKVSLEDLYNGTSKKLSLSRNVICTKCKGKGSKSGASMKCSGCQGSGMKVSIRHLGPSMIQQMQHPCNECKGTGETINDKDRCPQCKGEKVIQEKKVLEVIVEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALCGFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPESLSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRKQQAAQEAYDEDDDMQGGAQRVQCAQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DnaJ protein homolog Have a continuous role in plant development probably in the structural organization of compartments.confidentQ04960
Chaperone protein dnaJ 2 Have a continuous role in plant development probably in the structural organization of compartments.confidentP42825
DnaJ homolog subfamily A member 1 Co-chaperone of Hsc70. Seems to play a role in protein import into mitochondria.probableQ5NVI9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NLT, chain A
Confidence level:very confident
Coverage over the Query: 99-328
View the alignment between query and template
View the model in PyMOL
Template: 3LZ8, chain A
Confidence level:very confident
Coverage over the Query: 104-132,153-155,184,199-343
View the alignment between query and template
View the model in PyMOL
Template: 1XAO, chain A
Confidence level:very confident
Coverage over the Query: 248-368
View the alignment between query and template
View the model in PyMOL