Citrus Sinensis ID: 015736

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-

MDELLTPIMDEESPRLLQTISEHGGYAYVGMAAQAAADIRAAEAARDLAWEQLHSGPWHSVLPVWRDAYSMACLHGAKYHYRNGEFKEALRVLDMGVLMGGPVLRKDLDSAIETLSLKAREGENERFGEREANRLVSEEFNTAKALQVLPNRSLSCKLVVKRSALSLEGFLSEYFLSGSPVIITDCMAHWPARTNWNDLDYLKRVAGDRTVPVEVGKNYLCQDWKQELIPFSQFLERIQSNGSSASVPTYLAQHQLFDQINELRNDICIPDYCFVGGGELRSLNAWFGPAGTVTPLHHDPHHNILAQVVGKKYIRLYPASLSEELYPYSETMLCNSSQVDLDNIDETKFPKVRDLEFFDCILDEGEMLYIPPKWWHYVRSLSISFSVSFWWSDGGSSTAYS

ccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHccccccccccccccccccccHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHcccccEEEEEcccccccccCEEEEcHHHHHHHHHccccccccccHHccccHHHHHHHHHHcccccccccccccccccEEEEEccccccccccccccccEEEEEEEEEEEEECcccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEcccccccEEEcccEEEEEEcccccccccccc

***LLTPIMDEESPRLLQTISEHGGYAYVGMAAQAAADIRAAEAARDLAWEQLHSGPWHSVLPVWRDAYSMACLHGAKYHYRNGEFKEALRVLDMGVLMGGPVLRKDLDSAIETLS*************************TAKALQVLPNRSLSCKLVVKRSALSLEGFLSEYFLSGSPVIITDCMAHWPARTNWNDLDYLKRVAGDRTVPVEVGKNYLCQDWKQELIPFSQFLERIQSNGSSASVPTYLAQHQLFDQINELRNDICIPDYCFVGGGELRSLNAWFGPAGTVTPLHHDPHHNILAQVVGKKYIRLYPASLSEELYPYSETMLCNSSQVDLDNIDETKFPKVRDLEFFDCILDEGEMLYIPPKWWHYVRSLSISFSVSFWWSDGG******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDELLTPIMDEESPRLLQTISEHGGYAYVGMAAQAAADIRAAEAARDLAWEQLHSGPWHSVLPVWRDAYSMACLHGAKYHYRNGEFKEALRVLDMGVLMGGPVLxxxxxxxxxxxxxxxxxxxxxRFGEREANRLVSEEFNTAKALQVLPNRSLSCKLVVKRSALSLEGFLSEYFLSGSPVIITDCMAHWPARTNWNDLDYLKRVAGDRTVPVEVGKNYLCQDWKQELIPFSQFLERIQSNGSSASVPTYLAQHQLFDQINELRNDICIPDYCFVGGGELRSLNAWFGPAGTVTPLHHDPHHNILAQVVGKKYIRLYPASLSEELYPYSETMLCNSSQVDLDNIDETKFPKVRDLEFFDCILDEGEMLYIPPKWWHYVRSLSISFSVSFWWSDGGSSTAYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Lysine-specific demethylase 8	Histone demethylase required for G2/M phase cell cycle progression. Specifically demethylates dimethylated 'Lys-36' (H3K36me2) of histone H3, an epigenetic repressive mark, thereby acting as a transcription activator. Regulates expression of CCNA1 (cyclin-A1).	probable	Q1JP61
Lysine-specific demethylase 8	Histone demethylase required for G2/M phase cell cycle progression. Specifically demethylates dimethylated 'Lys-36' (H3K36me2) of histone H3, an epigenetic repressive mark, thereby acting as a transcription activator.	probable	A8E534
Lysine-specific demethylase 8	Histone demethylase required for G2/M phase cell cycle progression. Specifically demethylates dimethylated 'Lys-36' (H3K36me2) of histone H3, an epigenetic repressive mark, thereby acting as a transcription activator.	probable	B2GUS6

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D8C, chain A
Confidence level:very confident
Coverage over the Query: 155-398
View the alignment between query and template
View the model in PyMOL