Citrus Sinensis ID: 015746

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-

MATLASSSSSLLLSSPPSKLAQASLPPSLRLSFSSYSHLSSLVSISPSSFLACPASSRRSSVSAFTVKASAAEKKKVLIVNTNSGGHAVIGFYLAKELLGSGHEVTIMTVGDENSDKMKKPPFNRFNEIVSAGGKTVWGDPAEVGNVVGGVTFDVVLDNNGKNLDAVRPVADWAKSSGVKQFLFISSAGIYKPADEPPHVEGDVVKPDAGHVQVEKYISENFSNWASFRPQYMIGSGNNKDCEEWFFDRIVRKRPVPIPGSGMQFTNIAHVRDLSSMLTLAVENPEAASSNIFNLVSDRAVTLDGMAKLCAQAAGLPVEIVHYDPKAAGIDAKKAFPFRNMHFYAEPRAAKDILGWRSTTNLPEDLKERFEEYVKIGRDKKAMQFEIDDKILESLKVPIPV

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccHHHHHHHHHcccEEEEEcccccccccccccccccccHHHccccEEEEccHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHHHcccccccccccccEEEEEEHHHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHHHHHcccccEEEccccccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccc

************************************************************************EKKKVLIVNTNSGGHAVIGFYLAKELLGSGHEVTIMTVGDENSDKMKKPPFNRFNEIVSAGGKTVWGDPAEVGNVVGGVTFDVVLDNNGKNLDAVRPVADWAKSSGVKQFLFISSAGIYKPADEPPHVEGDVVKPDAGHVQVEKYISENFSNWASFRPQYMIGSGNNKDCEEWFFDRIVRKRPVPIPGSGMQFTNIAHVRDLSSMLTLAVENPEAASSNIFNLVSDRAVTLDGMAKLCAQAAGLPVEIVHYDPKAAGIDAKKAFPFRNMHFYAEPRAAKDILGWRSTTNLPEDLKERFEEYVKIGRDKKAMQFEIDDKILESLKVPI**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Chloroplast stem-loop binding protein of 41 kDa a, chloroplastic	Binds and cleaves RNA, particularly in stem-loops. Associates with pre-ribosomal particles in chloroplasts, and participates in chloroplast ribosomal RNA metabolism, probably during the final steps of 23S rRNA maturation. May enhance transcription by the plastid-encoded polymerase and translation in plastid via the stabilization of ribosome assembly intermediates. Required for chloroplast integrity. Involved in the regulation of the circadian system.	confident	Q9LYA9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RUF, chain A
Confidence level:very confident
Coverage over the Query: 71-377
View the alignment between query and template
View the model in PyMOL

Template: 3SXP, chain A
Confidence level:very confident
Coverage over the Query: 72-324,341-376
View the alignment between query and template
View the model in PyMOL