Citrus Sinensis ID: 015760

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-

MSSQRNQGGIVRIKELAMHVKHKVNLLGVVLEFSIPRKSQGTDYVCVLKIVDDSQQSPELLVNIFTSSIDQLPRVLSPRDLILLKNVMIKKHQAELSAVFYKDSSSFALFDGNSGSNLLPYQSSPQRFEITEAEERRINVLRQWCVGFEFSSGSNDYLLSLKDISEHRYFDLVCKVFHVSYDDSKGLWMLFVWDGTDVPPLSIPGKLEDEEHNPLPLHIESSPLDLETLRNFFPVGTVLRVSTDRSYENFGRYFTATGKWVRIRNMSCQVSSGMWHGLLQSSSKIRLFSDNDNVVWDYMRERISGGHGHMPIWTDPSSQFLTEVDWVNVASVTLMKIATQLQGNVRCCCIVRVVSIHPFQAEHYSSPNGSSEYTMKLTLEDPTARIHALLCGKEWVRFQLG

cccccccccEEEHHHHHHccccEEEEEEEEEEccccCCcccccEEEEEEEEEcccccccEEEEEEcccccccccccccccEEEEcEEEEEEEccEEEEEEEccccEEEEECccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccEEccccccccEEEEEEEEEEEEEEccccEEEEEEEccccccccccccccccccccccccccccccccHHHHccccccCEEEEEEEccccHHHHHcccccccEEEEEccEEEEEccEEEEEECccccEEEcccccHHHHHHHHHHHHccccccccccccccccccCCcccccccccHHHHHHccccccEEEEEEEEEEEcccccccccccccccEEEEEEEEEccccEEEEEEEcccccccccc

******Q*GIVRIKELAMHVKHKVNLLGVVLEFSIPRKSQGTDYVCVLKIVDDSQQSPELLVNIFTSSIDQLPRVLSPRDLILLKNVMIKKHQAELSAVFYKDSSSFALFDGNSGS*************ITEAEERRINVLRQWCVGFEFSSGSNDYLLSLKDISEHRYFDLVCKVFHVSYDDSKGLWMLFVWDGTDVPPLSIPG*********LPLHIESSPLDLETLRNFFPVGTVLRVSTDRSYENFGRYFTATGKWVRIRNMSCQVSSGMWHGLLQSSSKIRLFSDNDNVVWDYMRERISGGHGHMPIWTDPSSQFLTEVDWVNVASVTLMKIATQLQGNVRCCCIVRVVSIHPFQAEHYSSPNGSSEYTMKLTLEDPTARIHALLCGKEWVRFQLG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protection of telomeres protein 1a	Component of the telomerase ribonucleoprotein (RNP) complex that is essential for positive telomere length regulation. Binds specifically the telomerase RNA template component TER1. Does not bind single-stranded telomeric DNA.	probable	Q56Y52

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XJV, chain A
Confidence level:very confident
Coverage over the Query: 6-300
View the alignment between query and template
View the model in PyMOL

Template: 1JB7, chain A
Confidence level:very confident
Coverage over the Query: 8-202,226-267,278-400
View the alignment between query and template
View the model in PyMOL