Citrus Sinensis ID: 015810


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400
MSFKSILQDVKGELGSISRKGFDVRFGYGRSRSHRVVQDCSVVVDAFKQSCWANMPPELLRDVLLRIEASETTWPPRKNVVACAGVCRSWREIMKEIVKTLEVSGKLTFPISLKQPGPRGSLLQCYIKRNRSSQTYYLYLGLNQSSNDDGKFLLAARKCRRPTCTDYIISLNCDDVSKGSSTYIGRLRSNFLGTKFTIYDGHPPNAEARVTKCRSTRQVNMKQVSPKLLAGNYHVAHISYELNVLGSRGPRRMQCVMDAIPASSIEPGGVAPTQTEFHHSGLDSFPSIPFFRSKSIRAENFQNDQKEGLLVLRNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE
cccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccEEEccccccHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEEccccEEEccccccccccccEEEEEEEEccccccEEEEEEccccccccccccCEEEEEccCCccEEEEEcccccccccccccccccccccccccccccccccEEEEEEEEEEccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEccccEEEccccccEEEEcccccccccccccEEEEEEEEcccEEEEEccccccHHHHHHHHHHccccccccc
*SFKSILQDVKGELGSISRKGFDVR*********************FKQSCWANMPPELLRDVLLRIEASETTWPPRKNVVACAGVCRSWREIMKEIVKTLEVSGKLTFPISLKQPGPRGSLLQCYIKRNRSSQTYYLYLGLNQSSNDDGKFLLAARKCRRPTCTDYIISLNCDDVSKGSSTYIGRLRSNFLGTKFTIYDGHP*****************MKQVSPKLLAGNYHVAHISYELNVLGSRGPRRMQCVMDAI*********************************************KEGLLVLRNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFKSILQDVKGELGSISRKGFDVRFGYGRSRSHRVVQDCSVVVDAFKQSCWANMPPELLRDVLLRIEASETTWPPRKNVVACAGVCRSWREIMKEIVKTLEVSGKLTFPISLKQPGPRGSLLQCYIKRNRSSQTYYLYLGLNQSSNDDGKFLLAARKCRRPTCTDYIISLNCDDVSKGSSTYIGRLRSNFLGTKFTIYDGHPPNAEARVTKCRSTRQVNMKQVSPKLLAGNYHVAHISYELNVLGSRGPRRMQCVMDAIPASSIEPGGVAPTQTEFHHSGLDSFPSIPFFRSKSIRAENFQNDQKEGLLVLRNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVASLENGVAGQEHENVILQFGKVGKDVFTMDYQYPISAFQAFAICLSSFDTKIACE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tubby-like F-box protein 3 confidentQ8VY21
Tubby-like F-box protein 6 probableQ10LG8
Tubby-like F-box protein 11 probableQ8H485

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FIM, chain A
Confidence level:very confident
Coverage over the Query: 106-208,224-291,302-394
View the alignment between query and template
View the model in PyMOL
Template: 1C8Z, chain A
Confidence level:confident
Coverage over the Query: 115-218,234-282,299-400
View the alignment between query and template
View the model in PyMOL
Template: 3V7D, chain B
Confidence level:probable
Coverage over the Query: 47-96
View the alignment between query and template
View the model in PyMOL