Citrus Sinensis ID: 015820

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MQRLKISNISRYFNDLRALSQHRTSSSVTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRARMVDRDIAPKWSPPSLEQVSEDMVDRYFSPLSESELDLELPTKLREAFN
ccccccccHHHHHHHHHHHccccccccccccccccEEEEEEccEEEEEEccccccccccHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccEEEEEccEEEccccccccccccEEEccccccccccccccccccccHHHHccccccccHHHHHcccccccHHHHHHHcccccccccccHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccccccccccccccHHHHHccccccccccccccccHHHHHccc
cccEEEHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccEEEEEEccHHHcccEcHHHHHHHHHHHHHHHHcccccEEEEEccccEEEccEcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccEEEEEccEEEccccEEEEcccEEEEEccEEEcccHHHEccccccccHHHccccccccEEEEEEccccccHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEEcccccccccccHHHccHHHHHHHHccccccccccccccccccccc
MQRLKISNISRYFNDLRALSqhrtsssvtddlCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAwendpnigfvsmkgsgrafcaggdiVSLYHFMNQGKLEECKDFFRTLYSFIYLLGthlkphvailngvtmgggagvsipgtfrvacgktvfatpetligfhpdagasfylshlpghLGEFLALTGAKLNGAEMMACGLAThysvseklPLIEEELgklvtddpsVIEACLEKYsdlvypdknsvihridivdkcfglDTVEEIIDSLESeaslindpwcgsTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRARmvdrdiapkwsppsleqvsEDMVDRyfsplseseldlelPTKLREAFN
mqrlkisnISRYFNDLRALSQhrtsssvtddlCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKvslrsiregrfqtfdeclvREYRMSLQGVSRLISGDFYEGVRARMVdrdiapkwsppsleqvseDMVDRYFSPlseseldlelptklreafn
MQRLKISNISRYFNDLRALSQHRTSSSVTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRARMVDRDIAPKWSPPSLEQVSEDMVDRYFsplseseldlelpTKLREAFN
**********RYFNDL************TDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRARMVDRDIA*****************************************
************************************LVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKY************HRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRARMVDRDIAPKWSPPSLEQVSEDMVDRYFSPLSESELDLELPT*******
MQRLKISNISRYFNDLRALS*********DDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRARMVDRDIAPKWSPPSLEQVSEDMVDRYFSPLSESELDLELPTKLREAFN
*QRLKISNISRYFNDLRALSQHRTSSSVTD*LCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRARMVDRDIAPKWSPPSLEQVSEDMVDRYFSPLSESELDLELPTKL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQRLKISNISRYFNDLRALSQHRTSSSVTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRARMVDRDIAPKWSPPSLEQVSEDMVDRYFSPLSESELDLELPTKLREAFN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query399 2.2.26 [Sep-21-2011]
Q5XF59401 3-hydroxyisobutyryl-CoA h yes no 0.929 0.925 0.703 1e-148
Q8RXN4409 3-hydroxyisobutyryl-CoA h no no 0.997 0.973 0.593 1e-142
Q9LKJ1378 3-hydroxyisobutyryl-CoA h no no 0.899 0.949 0.483 6e-98
Q6NMB0378 Probable 3-hydroxyisobuty no no 0.864 0.912 0.498 9e-98
Q1PEY5378 Probable 3-hydroxyisobuty no no 0.902 0.952 0.475 1e-94
Q9SHJ8387 3-hydroxyisobutyryl-CoA h no no 0.887 0.914 0.407 3e-82
Q5ZJ60385 3-hydroxyisobutyryl-CoA h yes no 0.919 0.953 0.381 1e-69
Q6NVY1386 3-hydroxyisobutyryl-CoA h yes no 0.899 0.930 0.398 2e-69
Q8QZS1385 3-hydroxyisobutyryl-CoA h yes no 0.912 0.945 0.378 3e-68
A2VDC2385 3-hydroxyisobutyryl-CoA h N/A no 0.914 0.948 0.391 7e-68
>sp|Q5XF59|HIBC4_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=At3g60510 PE=2 SV=1 Back     alignment and function desciption
 Score =  523 bits (1348), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 261/371 (70%), Positives = 310/371 (83%)

Query: 28  VTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGS 87
            ++DL  QVLVEG   SR AILNRP ALNAL T+MG +L KL+K WE DPNIGFV MKGS
Sbjct: 31  TSEDLDYQVLVEGSGCSRTAILNRPPALNALTTHMGYRLQKLYKNWEEDPNIGFVMMKGS 90

Query: 88  GRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAG 147
           GRAFCAGGDIVSLYH   +G  +  ++FF +LYSFIYLLGT+LKPHVAILNGVTMGGG G
Sbjct: 91  GRAFCAGGDIVSLYHLRTRGSPDAIREFFSSLYSFIYLLGTYLKPHVAILNGVTMGGGTG 150

Query: 148 VSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMA 207
           VSIPGTFRVA  +T+FATPET+IGFHPDAGASF LSHLPG LGE+L LTG KL+GAEM+A
Sbjct: 151 VSIPGTFRVATDRTIFATPETIIGFHPDAGASFNLSHLPGRLGEYLGLTGLKLSGAEMLA 210

Query: 208 CGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCF 267
           CGLATHY  SE++P++EE+L KL+TDDPSV+E+CLEK +++ +P+K  VI RID+++KCF
Sbjct: 211 CGLATHYIRSEEVPVMEEQLKKLLTDDPSVVESCLEKCAEVAHPEKTGVIRRIDLLEKCF 270

Query: 268 GLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVR 327
             DTVEEIIDSLE EAS   D WC +TLR LKE+SPLSLKV+LRSIREGR QT D+CL+R
Sbjct: 271 SHDTVEEIIDSLEIEASRRKDTWCITTLRRLKESSPLSLKVALRSIREGRLQTLDQCLIR 330

Query: 328 EYRMSLQGVSRLISGDFYEGVRARMVDRDIAPKWSPPSLEQVSEDMVDRYFSPLSESELD 387
           EYRMSLQG+   +SG+F EGVRAR++D+D APKW PPSLE+VSEDMVD YF  L+ +E D
Sbjct: 331 EYRMSLQGLIGPMSGNFCEGVRARLIDKDEAPKWDPPSLEKVSEDMVDDYFCALTPTEPD 390

Query: 388 LELPTKLREAF 398
           L+LP KLRE+ 
Sbjct: 391 LDLPVKLRESI 401

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: -
>sp|Q8RXN4|HIBC5_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=At4g31810 PE=2 SV=1 Back     alignment and function description
>sp|Q9LKJ1|HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana GN=CHY1 PE=1 SV=1 Back     alignment and function description
>sp|Q6NMB0|HIBC3_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 3 OS=Arabidopsis thaliana GN=At2g30660 PE=2 SV=1 Back     alignment and function description
>sp|Q1PEY5|HIBC2_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 2 OS=Arabidopsis thaliana GN=At2g30650 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHJ8|HIBC8_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 OS=Arabidopsis thaliana GN=At1g06550 PE=2 SV=2 Back     alignment and function description
>sp|Q5ZJ60|HIBCH_CHICK 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Gallus gallus GN=HIBCH PE=2 SV=1 Back     alignment and function description
>sp|Q6NVY1|HIBCH_HUMAN 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2 Back     alignment and function description
>sp|Q8QZS1|HIBCH_MOUSE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus GN=Hibch PE=1 SV=1 Back     alignment and function description
>sp|A2VDC2|HIBCH_XENLA 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus laevis GN=hibch PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query399
255541138415 catalytic, putative [Ricinus communis] g 0.942 0.906 0.773 1e-174
224136292415 predicted protein [Populus trichocarpa] 0.949 0.913 0.782 1e-169
356504605407 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.914 0.896 0.747 1e-164
357512815401 3-hydroxyisobutyryl-CoA hydrolase-like p 0.957 0.952 0.700 1e-163
449442604406 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.997 0.980 0.688 1e-159
225453474405 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.994 0.980 0.680 1e-159
326507476424 predicted protein [Hordeum vulgare subsp 0.914 0.860 0.695 1e-151
357147338413 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.914 0.883 0.687 1e-150
225430480407 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.952 0.933 0.659 1e-150
363807438407 uncharacterized protein LOC100808892 [Gl 0.997 0.977 0.618 1e-149
>gi|255541138|ref|XP_002511633.1| catalytic, putative [Ricinus communis] gi|223548813|gb|EEF50302.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  617 bits (1590), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 291/376 (77%), Positives = 336/376 (89%)

Query: 24  TSSSVTDDLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVS 83
           ++S+  DDL  QVLVE KA SR AILNRPSALNALNTNMGA+L KL+K+WE +P++GFV 
Sbjct: 37  SNSTDDDDLDKQVLVESKAYSRTAILNRPSALNALNTNMGARLLKLYKSWEENPDVGFVM 96

Query: 84  MKGSGRAFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMG 143
           MKGSGRAFCAGGDIV+LY+ + +GKLE+CK+FFRTLY+FIY+LGT+LKPHVAIL+G+TMG
Sbjct: 97  MKGSGRAFCAGGDIVTLYNLVKKGKLEDCKEFFRTLYTFIYILGTYLKPHVAILDGITMG 156

Query: 144 GGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGA 203
           GGAGVSIPGTFR+A  KTVFATPETLIGFHPDAGASF+LSHLPGHLGE+LALTG  LNG 
Sbjct: 157 GGAGVSIPGTFRIATDKTVFATPETLIGFHPDAGASFHLSHLPGHLGEYLALTGETLNGV 216

Query: 204 EMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIV 263
           EM+ACGLATHYS SE+L LI+++LG+LVTDDPSVIEA LEKY DLV+PDK S +HRI+ V
Sbjct: 217 EMIACGLATHYSYSERLQLIDQQLGQLVTDDPSVIEATLEKYGDLVHPDKMSALHRIETV 276

Query: 264 DKCFGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDE 323
           D+CFG DTVEEI ++LESEAS  ND +C STLR LKEASPLSLKVSLRSIREGRFQT D+
Sbjct: 277 DRCFGYDTVEEIFEALESEASGTNDAFCNSTLRRLKEASPLSLKVSLRSIREGRFQTLDQ 336

Query: 324 CLVREYRMSLQGVSRLISGDFYEGVRARMVDRDIAPKWSPPSLEQVSEDMVDRYFSPLSE 383
           CLVREYRMSLQG+S+ IS DFYEGVRARMVDRD+APKW+PPSLE+VSEDMV+ YFS LSE
Sbjct: 337 CLVREYRMSLQGISKQISNDFYEGVRARMVDRDLAPKWNPPSLEKVSEDMVEHYFSRLSE 396

Query: 384 SELDLELPTKLREAFN 399
            E DL+LPT+ REAF 
Sbjct: 397 MEPDLDLPTEQREAFT 412

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224136292|ref|XP_002326825.1| predicted protein [Populus trichocarpa] gi|222835140|gb|EEE73575.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356504605|ref|XP_003521086.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357512815|ref|XP_003626696.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] gi|355520718|gb|AET01172.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449442604|ref|XP_004139071.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225453474|ref|XP_002274299.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial [Vitis vinifera] gi|297734569|emb|CBI16620.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|326507476|dbj|BAK03131.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357147338|ref|XP_003574307.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|225430480|ref|XP_002283319.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial [Vitis vinifera] gi|296082135|emb|CBI21140.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|363807438|ref|NP_001242643.1| uncharacterized protein LOC100808892 [Glycine max] gi|255634881|gb|ACU17799.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query399
TAIR|locus:2116797409 AT4G31810 [Arabidopsis thalian 0.947 0.924 0.607 2.6e-125
TAIR|locus:2054437378 AT2G30660 [Arabidopsis thalian 0.864 0.912 0.498 5.3e-88
TAIR|locus:2152069378 CHY1 "beta-hydroxyisobutyryl-C 0.864 0.912 0.486 2e-86
TAIR|locus:2054517378 AT2G30650 [Arabidopsis thalian 0.864 0.912 0.486 6.2e-85
TAIR|locus:2009180387 AT1G06550 [Arabidopsis thalian 0.854 0.881 0.416 3.1e-74
UNIPROTKB|Q6NVY1386 HIBCH "3-hydroxyisobutyryl-CoA 0.904 0.935 0.396 5.2e-65
UNIPROTKB|Q5ZJ60385 HIBCH "3-hydroxyisobutyryl-CoA 0.889 0.922 0.384 6e-64
UNIPROTKB|F1P188385 HIBCH "3-hydroxyisobutyryl-CoA 0.889 0.922 0.384 7.6e-64
MGI|MGI:1923792385 Hibch "3-hydroxyisobutyryl-Coe 0.907 0.940 0.381 5.4e-63
RGD|1308392385 Hibch "3-hydroxyisobutyryl-CoA 0.899 0.932 0.384 5.4e-63
TAIR|locus:2116797 AT4G31810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1231 (438.4 bits), Expect = 2.6e-125, P = 2.6e-125
 Identities = 234/385 (60%), Positives = 302/385 (78%)

Query:     1 MQRLK-ISNISRYFNDLRALSQHRTSS-----SVTD-DLCNQVLVEGKANSRMAILNRPS 53
             MQ +K +  +S     +R++S  R  S     S +D D  +QVLVEGKA SR AILN PS
Sbjct:     1 MQTVKALRRVSEPLQWVRSVSYGRRFSALPNYSASDADFEDQVLVEGKAKSRAAILNNPS 60

Query:    54 ALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEECK 113
             +LNAL+  M  +L +L+++WE +P I FV MKGSG+ FC+G D++SLYH +N+G  EE K
Sbjct:    61 SLNALSAPMVGRLKRLYESWEENPAISFVLMKGSGKTFCSGADVLSLYHSINEGNTEESK 120

Query:   114 DFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFH 173
              FF  LY F+YL GT+LKP++AI++GVTMG G G+S+PG FRVA  KTV A PE  IGFH
Sbjct:   121 LFFENLYKFVYLQGTYLKPNIAIMDGVTMGCGGGISLPGMFRVATDKTVLAHPEVQIGFH 180

Query:   174 PDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTD 233
             PDAGAS+YLS LPG+LGE+LALTG KLNG EM+ACGLATHY ++ +LPLIEE +GKL+TD
Sbjct:   181 PDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLATHYCLNARLPLIEERIGKLLTD 240

Query:   234 DPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCGS 293
             DP+VIE  L +Y DLVYPD +SV+H+I+++DK FGLDTVEEII+++E+EA+   + WC  
Sbjct:   241 DPAVIEDSLAQYGDLVYPDSSSVLHKIELIDKYFGLDTVEEIIEAMENEAANSCNEWCKK 300

Query:   294 TLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRARMV 353
             TL+ +KEASPLSLK++L+SIREGRFQT D+CL  EYR+S+ GVS+++SGDF EG+RAR+V
Sbjct:   301 TLKQIKEASPLSLKITLQSIREGRFQTLDQCLTHEYRISICGVSKVVSGDFCEGIRARLV 360

Query:   354 DRDIAPKWSPPSLEQVSEDMVDRYF 378
             D+D APKW PP LE VS+DMVD YF
Sbjct:   361 DKDFAPKWDPPRLEDVSKDMVDCYF 385
GO:0003824 "catalytic activity" evidence=IEA
GO:0003860 "3-hydroxyisobutyryl-CoA hydrolase activity" evidence=ISS
GO:0006635 "fatty acid beta-oxidation" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
TAIR|locus:2054437 AT2G30660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152069 CHY1 "beta-hydroxyisobutyryl-CoA hydrolase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054517 AT2G30650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009180 AT1G06550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NVY1 HIBCH "3-hydroxyisobutyryl-CoA hydrolase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJ60 HIBCH "3-hydroxyisobutyryl-CoA hydrolase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P188 HIBCH "3-hydroxyisobutyryl-CoA hydrolase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1923792 Hibch "3-hydroxyisobutyryl-Coenzyme A hydrolase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308392 Hibch "3-hydroxyisobutyryl-CoA hydrolase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5XF59HIBC4_ARATH3, ., 1, ., 2, ., -0.70350.92980.9251yesno
Q2HJ73HIBCH_BOVIN3, ., 1, ., 2, ., 40.38910.89470.9248yesno
Q28FR6HIBCH_XENTR3, ., 1, ., 2, ., 40.38600.91470.9480yesno
O74802HIBCH_SCHPO3, ., 1, ., 2, ., 40.33070.94480.8787yesno
Q5ZJ60HIBCH_CHICK3, ., 1, ., 2, ., 40.38150.91970.9532yesno
Q6NVY1HIBCH_HUMAN3, ., 1, ., 2, ., 40.39890.89970.9300yesno
Q8QZS1HIBCH_MOUSE3, ., 1, ., 2, ., 40.37830.91220.9454yesno
Q58EB4HIBCH_DANRE3, ., 1, ., 2, ., 40.39830.86960.9083yesno
Q5XIE6HIBCH_RAT3, ., 1, ., 2, ., 40.37850.91970.9532yesno
Q55GS6HIBCH_DICDI3, ., 1, ., 2, ., 40.39440.86460.9055yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.20.921
3rd Layer3.1.2.40.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.40.97.1
hypothetical protein (381 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_LG_VIII0916
enoyl-CoA hydratase (EC-4.2.1.17) (265 aa)
  •  • •0.907
grail3.0006050201
enoyl-CoA hydratase (EC-4.2.1.17) (265 aa)
  •  • •0.907
estExt_fgenesh4_pg.C_LG_VI1023
SubName- Full=Putative uncharacterized protein; (380 aa)
  •  • •0.907
eugene3.00013051
hypothetical protein (348 aa)
••   •  0.900

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
PLN02851407 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrol 0.0
PLN02157401 PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrol 0.0
PLN02874379 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrol 1e-142
PLN02988381 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrol 1e-120
PRK05617342 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrol 1e-119
pfam13766117 pfam13766, ECH_C, 2-enoyl-CoA Hydratase C-terminal 1e-47
cd06558195 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme 2e-39
COG1024257 COG1024, CaiD, Enoyl-CoA hydratase/carnithine race 2e-37
pfam00378245 pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami 2e-22
PRK06688259 PRK06688, PRK06688, enoyl-CoA hydratase; Provision 5e-20
PRK05809260 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata 2e-17
PRK06072248 PRK06072, PRK06072, enoyl-CoA hydratase; Provision 5e-17
PRK08138261 PRK08138, PRK08138, enoyl-CoA hydratase; Provision 7e-17
PRK05980260 PRK05980, PRK05980, enoyl-CoA hydratase; Provision 1e-16
PRK05862257 PRK05862, PRK05862, enoyl-CoA hydratase; Provision 1e-15
PRK05995262 PRK05995, PRK05995, enoyl-CoA hydratase; Provision 5e-15
PRK07657260 PRK07657, PRK07657, enoyl-CoA hydratase; Provision 3e-14
PRK06494259 PRK06494, PRK06494, enoyl-CoA hydratase; Provision 1e-13
PRK05870249 PRK05870, PRK05870, enoyl-CoA hydratase; Provision 2e-13
PRK06210272 PRK06210, PRK06210, enoyl-CoA hydratase; Provision 4e-13
PRK06190258 PRK06190, PRK06190, enoyl-CoA hydratase; Provision 1e-12
TIGR02280256 TIGR02280, PaaB1, phenylacetate degradation probab 2e-12
PLN02664275 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-d 2e-12
PLN02600251 PLN02600, PLN02600, enoyl-CoA hydratase 3e-12
PRK06023251 PRK06023, PRK06023, enoyl-CoA hydratase; Provision 4e-12
PRK06127269 PRK06127, PRK06127, enoyl-CoA hydratase; Provision 5e-12
PRK07659260 PRK07659, PRK07659, enoyl-CoA hydratase; Provision 7e-12
PRK07511260 PRK07511, PRK07511, enoyl-CoA hydratase; Provision 7e-12
PRK09674255 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; 4e-11
PRK07509262 PRK07509, PRK07509, enoyl-CoA hydratase; Provision 5e-11
PRK08260296 PRK08260, PRK08260, enoyl-CoA hydratase; Provision 9e-11
PRK06144262 PRK06144, PRK06144, enoyl-CoA hydratase; Provision 1e-10
PRK06142272 PRK06142, PRK06142, enoyl-CoA hydratase; Provision 3e-10
PLN02888265 PLN02888, PLN02888, enoyl-CoA hydratase 7e-10
PRK07799263 PRK07799, PRK07799, enoyl-CoA hydratase; Provision 8e-10
PRK08140262 PRK08140, PRK08140, enoyl-CoA hydratase; Provision 2e-09
TIGR02441 737 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c 2e-09
PRK03580261 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Pr 2e-09
PRK07658257 PRK07658, PRK07658, enoyl-CoA hydratase; Provision 4e-09
PRK07260255 PRK07260, PRK07260, enoyl-CoA hydratase; Provision 4e-09
PRK05674265 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydr 1e-08
PRK09120275 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydrata 2e-08
PRK06495257 PRK06495, PRK06495, enoyl-CoA hydratase; Provision 8e-08
PRK09245266 PRK09245, PRK09245, enoyl-CoA hydratase; Provision 2e-07
PRK12478298 PRK12478, PRK12478, enoyl-CoA hydratase; Provision 2e-07
PRK08150255 PRK08150, PRK08150, enoyl-CoA hydratase; Provision 3e-07
PRK07468262 PRK07468, PRK07468, enoyl-CoA hydratase; Provision 1e-06
PRK08252254 PRK08252, PRK08252, enoyl-CoA hydratase; Provision 2e-06
PRK08139266 PRK08139, PRK08139, enoyl-CoA hydratase; Validated 5e-06
PRK08258277 PRK08258, PRK08258, enoyl-CoA hydratase; Provision 6e-06
PRK05981266 PRK05981, PRK05981, enoyl-CoA hydratase; Provision 6e-06
TIGR01929259 TIGR01929, menB, naphthoate synthase (dihydroxynap 6e-06
TIGR03200360 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-car 8e-06
PRK07938249 PRK07938, PRK07938, enoyl-CoA hydratase; Provision 1e-05
TIGR02437 714 TIGR02437, FadB, fatty oxidation complex, alpha su 1e-05
PRK08272302 PRK08272, PRK08272, enoyl-CoA hydratase; Provision 3e-05
PRK07827260 PRK07827, PRK07827, enoyl-CoA hydratase; Provision 3e-05
PRK07327268 PRK07327, PRK07327, enoyl-CoA hydratase; Provision 5e-05
PRK08290288 PRK08290, PRK08290, enoyl-CoA hydratase; Provision 2e-04
PRK05864276 PRK05864, PRK05864, enoyl-CoA hydratase; Provision 4e-04
PRK08259254 PRK08259, PRK08259, enoyl-CoA hydratase; Provision 5e-04
TIGR03210256 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hyd 0.001
PLN02921327 PLN02921, PLN02921, naphthoate synthase 0.001
>gnl|CDD|178443 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information 
 Score =  598 bits (1543), Expect = 0.0
 Identities = 260/406 (64%), Positives = 327/406 (80%), Gaps = 8/406 (1%)

Query: 1   MQRLK-ISNISRYFNDLR--ALSQHRTSSSV-----TDDLCNQVLVEGKANSRMAILNRP 52
           MQR+K +  ++     +R  ++S  R+ S++      DDL +QVLVEG+A SR AILNRP
Sbjct: 1   MQRVKALRRVAVPLQWVRFGSVSYGRSFSALPNYAANDDLQDQVLVEGRAKSRAAILNRP 60

Query: 53  SALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEEC 112
           S+LNAL   M A+L +L+++WE +P+IGFV MKGSGRAFC+G D+VSLYH +N+G +EEC
Sbjct: 61  SSLNALTIPMVARLKRLYESWEENPDIGFVLMKGSGRAFCSGADVVSLYHLINEGNVEEC 120

Query: 113 KDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGF 172
           K FF  LY F+YL GT+LKP+VAI++G+TMG GAG+SIPG FRV   KTVFA PE  +GF
Sbjct: 121 KLFFENLYKFVYLQGTYLKPNVAIMDGITMGCGAGISIPGMFRVVTDKTVFAHPEVQMGF 180

Query: 173 HPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVT 232
           HPDAGAS+YLS LPG+LGE+LALTG KLNG EM+ACGLATHY ++ +LPLIEE LGKL+T
Sbjct: 181 HPDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLATHYCLNARLPLIEERLGKLLT 240

Query: 233 DDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDTVEEIIDSLESEASLINDPWCG 292
           DDP+VIE  L +Y DLVYPDK+SV+H+I+ +DKCFG DTVEEII++LE+EA+   D WC 
Sbjct: 241 DDPAVIEDSLAQYGDLVYPDKSSVLHKIETIDKCFGHDTVEEIIEALENEAASSYDEWCK 300

Query: 293 STLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRARM 352
             L+ +KEASPLSLKV+L+SIREGRFQT D+CL REYR+SL GVS+ +SGDF EGVRAR+
Sbjct: 301 KALKKIKEASPLSLKVTLQSIREGRFQTLDQCLAREYRISLCGVSKWVSGDFCEGVRARL 360

Query: 353 VDRDIAPKWSPPSLEQVSEDMVDRYFSPLSESELDLELPTKLREAF 398
           VD+D APKW PPSL +VS+DMVD YF+PL ESE +LELPT  RE +
Sbjct: 361 VDKDFAPKWDPPSLGEVSKDMVDCYFTPLDESESELELPTAQREPY 406

Length = 407
>gnl|CDD|177817 PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>gnl|CDD|178462 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>gnl|CDD|178568 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|235533 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|205939 pfam13766, ECH_C, 2-enoyl-CoA Hydratase C-terminal region Back     alignment and domain information
>gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>gnl|CDD|168377 PRK06072, PRK06072, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180295 PRK05862, PRK05862, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180298 PRK05870, PRK05870, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180472 PRK06210, PRK06210, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>gnl|CDD|178269 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>gnl|CDD|178210 PLN02600, PLN02600, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|168351 PRK06023, PRK06023, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236073 PRK07659, PRK07659, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181009 PRK07511, PRK07511, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|182026 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>gnl|CDD|181008 PRK07509, PRK07509, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236206 PRK08260, PRK08260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180424 PRK06144, PRK06144, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235714 PRK06142, PRK06142, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|215480 PLN02888, PLN02888, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|181122 PRK07799, PRK07799, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236163 PRK08140, PRK08140, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>gnl|CDD|179599 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180910 PRK07260, PRK07260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168168 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|236383 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>gnl|CDD|168580 PRK06495, PRK06495, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|183548 PRK12478, PRK12478, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181254 PRK08150, PRK08150, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180987 PRK07468, PRK07468, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181325 PRK08252, PRK08252, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181249 PRK08139, PRK08139, enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235661 PRK05981, PRK05981, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|200143 TIGR01929, menB, naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>gnl|CDD|132244 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|181174 PRK07938, PRK07938, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|236213 PRK08272, PRK08272, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236109 PRK07827, PRK07827, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235991 PRK07327, PRK07327, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236220 PRK08290, PRK08290, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168278 PRK05864, PRK05864, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236205 PRK08259, PRK08259, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|132254 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|178509 PLN02921, PLN02921, naphthoate synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 399
PLN02851407 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PLN02157401 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PLN02988381 3-hydroxyisobutyryl-CoA hydrolase 100.0
PLN02874379 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK05617342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 100.0
KOG1684401 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
PRK05980260 enoyl-CoA hydratase; Provisional 100.0
KOG1680290 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
PRK09076258 enoyl-CoA hydratase; Provisional 100.0
PRK08150255 enoyl-CoA hydratase; Provisional 100.0
PRK05862257 enoyl-CoA hydratase; Provisional 100.0
PRK06142272 enoyl-CoA hydratase; Provisional 100.0
PRK08140262 enoyl-CoA hydratase; Provisional 100.0
PRK09245266 enoyl-CoA hydratase; Provisional 100.0
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 100.0
PRK07657260 enoyl-CoA hydratase; Provisional 100.0
PRK07799263 enoyl-CoA hydratase; Provisional 100.0
PRK08258277 enoyl-CoA hydratase; Provisional 100.0
PRK08139266 enoyl-CoA hydratase; Validated 100.0
PRK07658257 enoyl-CoA hydratase; Provisional 100.0
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 100.0
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 100.0
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 100.0
PRK06127269 enoyl-CoA hydratase; Provisional 100.0
PRK08252254 enoyl-CoA hydratase; Provisional 100.0
PLN02600251 enoyl-CoA hydratase 100.0
PRK06563255 enoyl-CoA hydratase; Provisional 100.0
PRK07511260 enoyl-CoA hydratase; Provisional 100.0
PRK05995262 enoyl-CoA hydratase; Provisional 100.0
PRK08138261 enoyl-CoA hydratase; Provisional 100.0
PRK05981266 enoyl-CoA hydratase; Provisional 100.0
PRK07659260 enoyl-CoA hydratase; Provisional 100.0
PRK06494259 enoyl-CoA hydratase; Provisional 100.0
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 100.0
PRK07468262 enoyl-CoA hydratase; Provisional 100.0
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 100.0
PRK06688259 enoyl-CoA hydratase; Provisional 100.0
PRK05864276 enoyl-CoA hydratase; Provisional 100.0
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 100.0
PRK06210272 enoyl-CoA hydratase; Provisional 100.0
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 100.0
PRK06495257 enoyl-CoA hydratase; Provisional 100.0
PRK07327268 enoyl-CoA hydratase; Provisional 100.0
PRK03580261 carnitinyl-CoA dehydratase; Provisional 100.0
PRK07509262 enoyl-CoA hydratase; Provisional 100.0
PRK06144262 enoyl-CoA hydratase; Provisional 100.0
PRK07260255 enoyl-CoA hydratase; Provisional 100.0
PRK06143256 enoyl-CoA hydratase; Provisional 100.0
PRK08260296 enoyl-CoA hydratase; Provisional 100.0
PRK06072248 enoyl-CoA hydratase; Provisional 100.0
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 100.0
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 100.0
PRK08259254 enoyl-CoA hydratase; Provisional 100.0
PLN02888265 enoyl-CoA hydratase 100.0
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 100.0
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 100.0
PRK05870249 enoyl-CoA hydratase; Provisional 100.0
PRK07827260 enoyl-CoA hydratase; Provisional 100.0
PRK06023251 enoyl-CoA hydratase; Provisional 100.0
PRK07854243 enoyl-CoA hydratase; Provisional 100.0
PRK07938249 enoyl-CoA hydratase; Provisional 100.0
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 100.0
PLN02921327 naphthoate synthase 100.0
PRK12478298 enoyl-CoA hydratase; Provisional 100.0
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 100.0
PRK08321302 naphthoate synthase; Validated 100.0
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PRK06190258 enoyl-CoA hydratase; Provisional 100.0
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 100.0
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 100.0
PRK05869222 enoyl-CoA hydratase; Validated 100.0
PRK08290288 enoyl-CoA hydratase; Provisional 100.0
KOG1679291 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
PRK08788287 enoyl-CoA hydratase; Validated 100.0
PRK11730 715 fadB multifunctional fatty acid oxidation complex 100.0
PRK06213229 enoyl-CoA hydratase; Provisional 100.0
PRK08272302 enoyl-CoA hydratase; Provisional 100.0
KOG1681292 consensus Enoyl-CoA isomerase [Lipid transport and 100.0
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 100.0
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 100.0
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 100.0
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 100.0
KOG1682287 consensus Enoyl-CoA isomerase [Lipid transport and 100.0
KOG0016266 consensus Enoyl-CoA hydratase/isomerase [Lipid tra 100.0
PLN02267239 enoyl-CoA hydratase/isomerase family protein 100.0
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 100.0
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 100.0
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 100.0
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 100.0
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 100.0
PF13766118 ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PD 99.86
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.77
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.76
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 99.59
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 99.5
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 99.46
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 99.41
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 99.38
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 99.33
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 99.31
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 99.22
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 99.15
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 98.7
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 98.55
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 98.54
KOG1683380 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA 98.5
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 98.43
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 98.33
PRK10949618 protease 4; Provisional 98.28
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 98.26
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 98.26
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 98.2
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 98.17
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 98.13
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 98.13
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 98.11
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 98.1
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 98.07
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 98.05
PRK07189301 malonate decarboxylase subunit beta; Reviewed 97.96
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 97.88
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 97.83
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 97.81
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 97.81
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 97.79
PRK11778330 putative inner membrane peptidase; Provisional 97.78
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 97.75
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 97.72
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 97.53
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 97.49
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 97.26
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 97.13
COG1030436 NfeD Membrane-bound serine protease (ClpP class) [ 97.05
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 97.04
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 97.02
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 96.89
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 96.85
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 96.79
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 96.35
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 96.18
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 95.88
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 95.84
PRK10949 618 protease 4; Provisional 94.72
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 93.96
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase compon 93.83
PLN02157401 3-hydroxyisobutyryl-CoA hydrolase-like protein 93.4
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 91.88
KOG0840275 consensus ATP-dependent Clp protease, proteolytic 91.82
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information 
Probab=100.00  E-value=1.7e-69  Score=538.47  Aligned_cols=365  Identities=68%  Similarity=1.170  Sum_probs=326.5

Q ss_pred             CCCcEEEEeeCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHHhcCCCceEEEEecCCCCcccCCChhhHHHhhccCChHH
Q 015820           32 LCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEE  111 (399)
Q Consensus        32 ~~~~v~~~~~~~v~~Itlnrp~~~Nal~~~~~~eL~~~l~~~~~d~~v~~vVltg~g~~F~aG~Dl~~~~~~~~~~~~~~  111 (399)
                      ..+.|.++..+++++||||||+++|+||.+|+.+|.++|+.++.|+++++|||+|.|++||+|+|++.+...........
T Consensus        40 ~~~~v~~e~~~~~~~ItLNRP~~lNALs~~m~~eL~~al~~~~~D~~vrvVVL~G~GkaFcAGgDl~~l~~~~~~~~~~~  119 (407)
T PLN02851         40 LQDQVLVEGRAKSRAAILNRPSSLNALTIPMVARLKRLYESWEENPDIGFVLMKGSGRAFCSGADVVSLYHLINEGNVEE  119 (407)
T ss_pred             CCCCeEEEEECCEEEEEECCCCcCCCCCHHHHHHHHHHHHHHHhCCCceEEEEECCCCCccCCcCHHHHHhhccccchHH
Confidence            45678899999999999999999999999999999999999999999999999999999999999999865322222344


Q ss_pred             HHHHHHHHHHHHHHHccCCCcEEEEEcceeecccccccccCCeEEEeCceEEeccccccCccCCCchhHHHhhcchHHHH
Q 015820          112 CKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGE  191 (399)
Q Consensus       112 ~~~~~~~~~~l~~~i~~~~kP~IAav~G~a~GgG~~Lal~cD~ria~~~a~f~~pe~~~Gl~p~~g~~~~L~r~~g~~a~  191 (399)
                      ...++...+.+.+.+.++|||+||+|||+|+|||++|+++||+||++++++|++||+++|++|++|++++|+|++|..+.
T Consensus       120 ~~~~f~~~~~l~~~i~~~pKPvIA~v~G~amGGG~gLal~~D~rVate~a~famPE~~iGl~PdvG~s~~L~rl~g~~g~  199 (407)
T PLN02851        120 CKLFFENLYKFVYLQGTYLKPNVAIMDGITMGCGAGISIPGMFRVVTDKTVFAHPEVQMGFHPDAGASYYLSRLPGYLGE  199 (407)
T ss_pred             HHHHHHHHHHHHHHHHhCCCCEEEEEcCEEeeHHHHHHHhCCEEEEeCCceEecchhccCCCCCccHHHHHHHhcCHHHH
Confidence            55677788888899999999999999999999999999999999999999999999999999999999999999998899


Q ss_pred             HHHHcCCCCCHHHHHHcCccceecCCCChhHHHHHHhhhcCCChHHHHHHHHHhccccCCCcchhhhHHHHHHhhcCCCC
Q 015820          192 FLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLDT  271 (399)
Q Consensus       192 ~l~ltG~~i~A~eA~~~GLv~~vv~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~f~~~~  271 (399)
                      +|+|||++++|+||+++||++++|+++++..+.+.+.++...++..++..+++|.....+...........|++||+.++
T Consensus       200 ~L~LTG~~i~a~eA~~~GLa~~~v~~~~l~~l~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~I~~~F~~~s  279 (407)
T PLN02851        200 YLALTGQKLNGVEMIACGLATHYCLNARLPLIEERLGKLLTDDPAVIEDSLAQYGDLVYPDKSSVLHKIETIDKCFGHDT  279 (407)
T ss_pred             HHHHhCCcCCHHHHHHCCCceeecCHhhHHHHHHHHHhhccCCHHHHHHHHHHhccccCCCcccHHHHHHHHHHHhCCCC
Confidence            99999999999999999999999999999878888887777778888889999976533333455666889999999999


Q ss_pred             HHHHHHHHHhhhccCCchHHHHHHHHHHhcCchHHHHHHHHHHhcccCCHHHHHHHHHHHHHHhhccCCCCcHHhhHhhh
Q 015820          272 VEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRAR  351 (399)
Q Consensus       272 ~~ei~~~l~~~~~~~~~~~a~~~a~~i~~~~p~a~~~~k~~l~~~~~~~~~~~l~~e~~~~~~~~~~~~s~d~~egv~af  351 (399)
                      +++|+++|+........+|++++++.|.+.||.|+++|.+.++.+...++.++++.|+++..+++....++||.|||+|.
T Consensus       280 v~~I~~~L~~~~~~~~~~wa~~~~~~l~~~SP~Sl~vt~~~~~~~~~~sl~e~l~~E~~l~~~~~~~~~~~DF~EGVRA~  359 (407)
T PLN02851        280 VEEIIEALENEAASSYDEWCKKALKKIKEASPLSLKVTLQSIREGRFQTLDQCLAREYRISLCGVSKWVSGDFCEGVRAR  359 (407)
T ss_pred             HHHHHHHHHhcccccchHHHHHHHHHHHhcCcHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHhcCccchHHHHHHHH
Confidence            99999999975444457999999999999999999999999999999999999999999998876312279999999999


Q ss_pred             hccCCCCCCCCCCCccCCCHHHHhcccCCCCCCCCCcccChhhhh
Q 015820          352 MVDRDIAPKWSPPSLEQVSEDMVDRYFSPLSESELDLELPTKLRE  396 (399)
Q Consensus       352 l~ek~r~p~~~~~~~~~v~~~~v~~~~~~~~~~~~~~~~~~~~~~  396 (399)
                      ||||+++|+|+|+++++|+++.|+.+|.|+..++++|++|+..++
T Consensus       360 LIDKd~~P~W~p~sl~~V~~~~v~~~f~~~~~~~~~l~~~~~~~~  404 (407)
T PLN02851        360 LVDKDFAPKWDPPSLGEVSKDMVDCYFTPLDESESELELPTAQRE  404 (407)
T ss_pred             hcCCCCCCCCCCCChhhCCHHHHHHHhCCCCCCcccccCCccccc
Confidence            999999999999999999999999999999776668999985543

>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>KOG1684 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PF13766 ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PDB: 3JU1_A 3BPT_A Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>KOG0840 consensus ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
3bpt_A363 Crystal Structure Of Human Beta-Hydroxyisobutyryl-C 3e-66
4hdt_A353 Crystal Structure Of A Carnitinyl-Coa Dehydratase F 3e-48
4j2u_A365 Crystal Structure Of An Enoyl-coa Hydratase From Rh 1e-34
3ju1_A407 Crystal Structure Of Enoyl-Coa HydrataseISOMERASE F 2e-31
2hw5_A286 The Crystal Structure Of Human Enoyl-Coenzyme A (Co 5e-16
2ej5_A257 Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydr 3e-14
1ey3_A258 Structure Of Enoyl-Coa Hydratase Complexed With The 3e-14
1mj3_A260 Crystal Structure Analysis Of Rat Enoyl-Coa Hydrata 3e-14
1dub_A261 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 3e-14
3pzk_A257 Crystal Structure Of The Mycobacterium Tuberculosis 4e-14
3q0j_A258 Crystal Structure Of The Mycobacterium Tuberculosis 5e-14
3r0o_A273 Crystal Structure Of Carnitinyl-Coa Hydratase From 7e-14
3h81_A278 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 7e-14
3hrx_A254 Crystal Structure Of Phenylacetic Acid Degradation 1e-13
2pbp_A258 Crystal Structure Of Enoyl-Coa Hydrates Subunit I ( 1e-12
3moy_A263 Crystal Structure Of Probable Enoyl-Coa Hydratase F 3e-12
3r9t_A267 Structure Of Echa1_1 From Mycobacterium Paratubercu 8e-12
3r9s_A267 Structure Of A Carnitinyl-Coa Dehydratase From Myco 9e-12
3rrv_A276 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 1e-11
3qmj_A256 Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 Fr 3e-11
3p5m_A255 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 3e-11
3rsi_A265 The Structure Of A Putative Enoyl-Coa HydrataseISOM 1e-10
2j5i_A276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 1e-10
2vsu_E276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 1e-10
2vsu_C275 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 1e-10
2vsu_A276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 1e-10
2vss_E276 Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C 1e-10
2j5i_B276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 1e-10
2vsu_F276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 1e-10
2j5i_I276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 1e-10
2vss_F276 Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C 2e-10
4f47_A278 The Structure Of Enoyl-Coa Hydratase Echa19 From My 4e-09
4fzw_A258 Crystal Structure Of The Paaf-paag Hydratase-isomer 4e-09
3tlf_A274 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 8e-09
1uiy_A253 Crystal Structure Of Enoyl-Coa Hydratase From Therm 1e-08
2f6q_A280 The Crystal Structure Of Human Peroxisomal Delta3, 2e-08
3p85_A270 Crystal Structure Enoyl-Coa Hydratase From Mycobact 2e-08
3qyr_A253 Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 M 3e-08
3kqf_A265 1.8 Angstrom Resolution Crystal Structure Of Enoyl- 4e-08
2vre_A296 Crystal Structure Of Human Peroxisomal Delta3,5, De 1e-07
3qxz_A265 Crystal Structure Of A Probable Enoyl-Coa Hydratase 1e-07
3sll_A290 Crystal Structure Of A Probable Enoyl-Coa Hydratase 2e-07
3pea_A261 Crystal Structure Of Enoyl-Coa Hydratase From Bacil 4e-07
4fzw_C274 Crystal Structure Of The Paaf-paag Hydratase-isomer 5e-07
3pe8_A256 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 9e-07
2uzf_A273 Crystal Structure Of Staphylococcus Aureus 1,4-Dihy 2e-06
3lke_A263 Crystal Structure Of Enoyl-Coa Hydratase From Bacil 2e-06
3qka_A261 Crystal Structure Of Enoyl-Coa Hydratase Echa5 From 2e-06
1dci_A275 Dienoyl-Coa Isomerase Length = 275 2e-06
1nzy_B269 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo 2e-06
1nzy_A269 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo 2e-06
2iex_A272 Crystal Structure Of Dihydroxynapthoic Acid Synthet 3e-06
3myb_A286 Crystal Structure Of Enoyl-Coa Hydratase Mycobacter 3e-06
3oc7_A267 Crystal Structure Of An Enoyl-Coa Hydratase From My 5e-06
1jxz_A269 Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coe 6e-06
3fdu_A266 Crystal Structure Of A Putative Enoyl-Coa Hydratase 8e-06
3he2_A264 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 1e-05
3trr_A256 Crystal Structure Of A Probable Enoyl-Coa Hydratase 2e-05
3hin_A275 Crystal Structure Of Putative Enoyl-Coa Hydratase F 1e-04
3ome_A282 Crystal Structure Of A Probable Enoyl-Coa Hydratase 1e-04
3t3w_A279 Crystal Structure Of Probable Enoyl-Coa Hydratase F 1e-04
2vx2_A287 Crystal Structure Of Human Enoyl Coenzyme A Hydrata 2e-04
3g64_A279 Crystal Structure Of Putative Enoyl-Coa Hydratase F 3e-04
3qxi_A265 Crystal Structure Of Enoyl-Coa Hydratase Echa1 From 4e-04
3i47_A268 Crystal Structure Of Putative Enoyl Coa HydrataseIS 5e-04
3m6m_A305 Crystal Structure Of Rpff Complexed With Rec Domain 6e-04
>pdb|3BPT|A Chain A, Crystal Structure Of Human Beta-Hydroxyisobutyryl-Coa Hydrolase In Complex With Quercetin Length = 363 Back     alignment and structure 
Iteration: 1

 Score =  248 bits (634), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 140/352 (39%), Positives = 207/352 (58%), Gaps = 12/352 (3%)
Query: 31  DLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSG-R 89
           D   +VL+  K  + +  LNRP  LNAL  N   ++    K WE DP    + +KG+G +
Sbjct: 3   DAAEEVLLGKKGCTGVITLNRPKFLNALTLNXIRQIYPQLKKWEQDPETFLIIIKGAGGK 62
Query: 90  AFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVS 149
           AFCAGGDI  +     + K +    FFR  Y     +G+  KP+VA+++G+T GGG G+S
Sbjct: 63  AFCAGGDIRVISE-AEKAKQKIAPVFFREEYXLNNAVGSCQKPYVALIHGITXGGGVGLS 121
Query: 150 IPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACG 209
           + G FRVA  K +FA PET IG  PD G  ++L  L G LG FLALTG +L G ++   G
Sbjct: 122 VHGQFRVATEKCLFAXPETAIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRAG 181
Query: 210 LATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKY--SDLVYPDKNSVIHR-IDIVDKC 266
           +ATH+  SEKL  +EE+L  L +     I + LE Y     +  DK+ ++    D ++ C
Sbjct: 182 IATHFVDSEKLAXLEEDLLALKSPSKENIASVLENYHTESKIDRDKSFILEEHXDKINSC 241
Query: 267 FGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLV 326
           F  +TVEEII++L+ + S     +    L+++ + SP SLK++LR + EG  +T  E L 
Sbjct: 242 FSANTVEEIIENLQQDGS----SFALEQLKVINKXSPTSLKITLRQLXEGSSKTLQEVLT 297
Query: 327 REYRMSLQGVSRLISGDFYEGVRARMVDRDIAPKWSPPSLEQVSEDMVDRYF 378
            EYR+S Q   R    DF+EGVRA ++D+D +PKW P  L++V+E+ ++ +F
Sbjct: 298 XEYRLS-QACXR--GHDFHEGVRAVLIDKDQSPKWKPADLKEVTEEDLNNHF 346
>pdb|4HDT|A Chain A, Crystal Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Thermoresistibile Length = 353 Back     alignment and structure
>pdb|4J2U|A Chain A, Crystal Structure Of An Enoyl-coa Hydratase From Rhodobacter Sphaeroides 2.4.1 Length = 365 Back     alignment and structure
>pdb|3JU1|A Chain A, Crystal Structure Of Enoyl-Coa HydrataseISOMERASE FAMILY PROTEIN Length = 407 Back     alignment and structure
>pdb|2HW5|A Chain A, The Crystal Structure Of Human Enoyl-Coenzyme A (Coa) Hydratase Short Chain 1, Echs1 Length = 286 Back     alignment and structure
>pdb|2EJ5|A Chain A, Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydratase Subunit Ii) From Geobacillus Kaustophilus Length = 257 Back     alignment and structure
>pdb|1EY3|A Chain A, Structure Of Enoyl-Coa Hydratase Complexed With The Substrate Dac-Coa Length = 258 Back     alignment and structure
>pdb|1MJ3|A Chain A, Crystal Structure Analysis Of Rat Enoyl-Coa Hydratase In Complex With Hexadienoyl-Coa Length = 260 Back     alignment and structure
>pdb|1DUB|A Chain A, 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6.5 Length = 261 Back     alignment and structure
>pdb|3PZK|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Apo Form Length = 257 Back     alignment and structure
>pdb|3Q0J|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Complex With The Inhibitor Acetoacetylcoa Length = 258 Back     alignment and structure
>pdb|3R0O|A Chain A, Crystal Structure Of Carnitinyl-Coa Hydratase From Mycobacterium Avium Length = 273 Back     alignment and structure
>pdb|3H81|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 278 Back     alignment and structure
>pdb|3HRX|A Chain A, Crystal Structure Of Phenylacetic Acid Degradation Protein Paag Length = 254 Back     alignment and structure
>pdb|2PBP|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates Subunit I (Gk_2039) From Geobacillus Kaustophilus Hta426 Length = 258 Back     alignment and structure
>pdb|3MOY|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycob Smegmatis Length = 263 Back     alignment and structure
>pdb|3R9T|A Chain A, Structure Of Echa1_1 From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 267 Back     alignment and structure
>pdb|3R9S|A Chain A, Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Avium 104 Length = 267 Back     alignment and structure
>pdb|3RRV|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 276 Back     alignment and structure
>pdb|3QMJ|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 From Mycobacterium Marinum Length = 256 Back     alignment and structure
>pdb|3P5M|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Avium Length = 255 Back     alignment and structure
>pdb|3RSI|A Chain A, The Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 265 Back     alignment and structure
>pdb|2J5I|A Chain A, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|2VSU|E Chain E, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 Back     alignment and structure
>pdb|2VSU|C Chain C, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 275 Back     alignment and structure
>pdb|2VSU|A Chain A, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism. Length = 276 Back     alignment and structure
>pdb|2VSS|E Chain E, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 Back     alignment and structure
>pdb|2J5I|B Chain B, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|2VSU|F Chain F, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 Back     alignment and structure
>pdb|2J5I|I Chain I, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|2VSS|F Chain F, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 Back     alignment and structure
>pdb|4F47|A Chain A, The Structure Of Enoyl-Coa Hydratase Echa19 From Mycobacterium Marinum Length = 278 Back     alignment and structure
>pdb|4FZW|A Chain A, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 258 Back     alignment and structure
>pdb|3TLF|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 274 Back     alignment and structure
>pdb|1UIY|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Thermus Thermophilus Hb8 Length = 253 Back     alignment and structure
>pdb|2F6Q|A Chain A, The Crystal Structure Of Human Peroxisomal Delta3, Delta2 Enoyl Coa Isomerase (Peci) Length = 280 Back     alignment and structure
>pdb|3P85|A Chain A, Crystal Structure Enoyl-Coa Hydratase From Mycobacterium Avium Length = 270 Back     alignment and structure
>pdb|3QYR|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|3KQF|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis. Length = 265 Back     alignment and structure
>pdb|2VRE|A Chain A, Crystal Structure Of Human Peroxisomal Delta3,5, Delta2,4-Dienoyl Coa Isomerase Length = 296 Back     alignment and structure
>pdb|3QXZ|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 Back     alignment and structure
>pdb|3SLL|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 290 Back     alignment and structure
>pdb|3PEA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis Str. 'ames Ancestor' Length = 261 Back     alignment and structure
>pdb|4FZW|C Chain C, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 274 Back     alignment and structure
>pdb|3PE8|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 256 Back     alignment and structure
>pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa Length = 273 Back     alignment and structure
>pdb|3LKE|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Halodurans Length = 263 Back     alignment and structure
>pdb|3QKA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa5 From Mycobacterium Marinum Length = 261 Back     alignment and structure
>pdb|1DCI|A Chain A, Dienoyl-Coa Isomerase Length = 275 Back     alignment and structure
>pdb|1NZY|B Chain B, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 Back     alignment and structure
>pdb|1NZY|A Chain A, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 Back     alignment and structure
>pdb|2IEX|A Chain A, Crystal Structure Of Dihydroxynapthoic Acid Synthetase (Gk2873) From Geobacillus Kaustophilus Hta426 Length = 272 Back     alignment and structure
>pdb|3MYB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Mycobacterium Smegm Length = 286 Back     alignment and structure
>pdb|3OC7|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase From Mycobacterium Avium Length = 267 Back     alignment and structure
>pdb|1JXZ|A Chain A, Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coenzyme A Dehalogenase Complexed With 4-Hydroxybenzoyl-Coenzyme A (Product) Length = 269 Back     alignment and structure
>pdb|3FDU|A Chain A, Crystal Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Acinetobacter Baumannii Length = 266 Back     alignment and structure
>pdb|3HE2|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 264 Back     alignment and structure
>pdb|3TRR|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 256 Back     alignment and structure
>pdb|3HIN|A Chain A, Crystal Structure Of Putative Enoyl-Coa Hydratase From Rhodopseudomonas Palustris Cga009 Length = 275 Back     alignment and structure
>pdb|3OME|A Chain A, Crystal Structure Of A Probable Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 282 Back     alignment and structure
>pdb|3T3W|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycobacterium Thermoresistibile Length = 279 Back     alignment and structure
>pdb|2VX2|A Chain A, Crystal Structure Of Human Enoyl Coenzyme A Hydratase Domain-Containing Protein 3 (Echdc3) Length = 287 Back     alignment and structure
>pdb|3G64|A Chain A, Crystal Structure Of Putative Enoyl-Coa Hydratase From Streptomyces Coelicolor A3(2) Length = 279 Back     alignment and structure
>pdb|3QXI|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa1 From Mycobacterium Marinum Length = 265 Back     alignment and structure
>pdb|3I47|A Chain A, Crystal Structure Of Putative Enoyl Coa HydrataseISOMERASE (Crotonase) From Legionella Pneumophila Subsp. Pneumophila Str. Philadelphia 1 Length = 268 Back     alignment and structure
>pdb|3M6M|A Chain A, Crystal Structure Of Rpff Complexed With Rec Domain Of Rpfc Length = 305 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 1e-161
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 1e-153
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 2e-32
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 1e-30
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 2e-30
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 3e-30
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 3e-30
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 1e-29
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 2e-29
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, struct 2e-29
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 1e-28
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 1e-28
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 2e-28
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 2e-28
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 3e-28
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 3e-28
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 6e-28
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 5e-27
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 1e-26
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 5e-26
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 2e-25
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 3e-25
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 3e-25
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 5e-25
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 8e-25
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 1e-24
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 2e-24
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 2e-24
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 2e-24
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 4e-24
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 6e-24
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 6e-24
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 1e-23
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 2e-23
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 2e-23
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 3e-23
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 4e-23
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 5e-23
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 5e-23
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 6e-23
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 8e-23
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 1e-22
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 3e-22
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 3e-22
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 3e-22
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 4e-22
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 6e-22
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 6e-22
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 9e-22
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 1e-21
3t3w_A279 Probable enoyl-COA hydratase; ssgcid, structural g 4e-21
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 4e-21
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 4e-21
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 7e-21
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 8e-21
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 3e-20
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 3e-20
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 5e-20
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 1e-19
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 3e-19
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 4e-19
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 1e-18
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 2e-18
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 2e-18
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 3e-18
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 5e-18
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 1e-17
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 3e-17
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 3e-17
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 3e-14
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 3e-14
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-10
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 2e-11
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Length = 363 Back     alignment and structure
 Score =  456 bits (1176), Expect = e-161
 Identities = 140/363 (38%), Positives = 210/363 (57%), Gaps = 12/363 (3%)

Query: 31  DLCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSG-R 89
           D   +VL+  K  + +  LNRP  LNAL  NM  ++    K WE DP    + +KG+G +
Sbjct: 3   DAAEEVLLGKKGCTGVITLNRPKFLNALTLNMIRQIYPQLKKWEQDPETFLIIIKGAGGK 62

Query: 90  AFCAGGDIVSLYHFMNQGKLEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVS 149
           AFCAGGDI  +       + +    FFR  Y     +G+  KP+VA+++G+TMGGG G+S
Sbjct: 63  AFCAGGDIRVISEAEKAKQ-KIAPVFFREEYMLNNAVGSCQKPYVALIHGITMGGGVGLS 121

Query: 150 IPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLGEFLALTGAKLNGAEMMACG 209
           + G FRVA  K +FA PET IG  PD G  ++L  L G LG FLALTG +L G ++   G
Sbjct: 122 VHGQFRVATEKCLFAMPETAIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRAG 181

Query: 210 LATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNS---VIHRIDIVDKC 266
           +ATH+  SEKL ++EE+L  L +     I + LE Y      D++    +   +D ++ C
Sbjct: 182 IATHFVDSEKLAMLEEDLLALKSPSKENIASVLENYHTESKIDRDKSFILEEHMDKINSC 241

Query: 267 FGLDTVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLV 326
           F  +TVEEII++L+ +       +    L+++ + SP SLK++LR + EG  +T  E L 
Sbjct: 242 FSANTVEEIIENLQQDG----SSFALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLT 297

Query: 327 REYRMSLQGVSRLISGDFYEGVRARMVDRDIAPKWSPPSLEQVSEDMVDRYFSPLSESEL 386
            EYR+S   +      DF+EGVRA ++D+D +PKW P  L++V+E+ ++ +F  L  S+L
Sbjct: 298 MEYRLSQACMRG---HDFHEGVRAVLIDKDQSPKWKPADLKEVTEEDLNNHFKSLGSSDL 354

Query: 387 DLE 389
              
Sbjct: 355 KFA 357
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Length = 407 Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 Back     alignment and structure
>3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287 Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query399
4hdt_A353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 100.0
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 100.0
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 100.0
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 100.0
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 100.0
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 100.0
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 100.0
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 100.0
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 100.0
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 100.0
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 100.0
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 100.0
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 100.0
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 100.0
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 100.0
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 100.0
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 100.0
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 100.0
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 100.0
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 100.0
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 100.0
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 100.0
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 100.0
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 100.0
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 100.0
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 100.0
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 100.0
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 100.0
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 100.0
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 100.0
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 100.0
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 100.0
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 100.0
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 100.0
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 100.0
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 100.0
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 100.0
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 100.0
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 100.0
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 100.0
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 100.0
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 100.0
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 100.0
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 100.0
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 100.0
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 100.0
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 100.0
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 100.0
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 100.0
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 100.0
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 100.0
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 100.0
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 100.0
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 100.0
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 100.0
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 100.0
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 100.0
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 100.0
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 100.0
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 100.0
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 100.0
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 100.0
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 100.0
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 100.0
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 100.0
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 100.0
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 100.0
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 100.0
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 100.0
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 100.0
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 100.0
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 100.0
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 100.0
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 100.0
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.8
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.78
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.76
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 99.55
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 99.54
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 99.47
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 99.43
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 98.9
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 98.56
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 98.49
2f6i_A215 ATP-dependent CLP protease, putative; structural g 98.47
2w3p_A556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 98.39
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 98.36
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 98.35
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 97.97
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 97.79
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 97.75
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 97.67
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 97.65
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 97.46
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 97.39
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 97.3
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 97.28
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 96.99
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 96.83
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 96.77
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 96.32
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 96.15
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 96.11
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 95.72
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 95.3
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 95.27
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 95.26
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 93.73
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 93.61
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 91.74
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 88.07
3k8x_A758 Acetyl-COA carboxylase; transferase, carboxyltrans 83.03
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
Probab=100.00  E-value=6.9e-69  Score=529.84  Aligned_cols=344  Identities=35%  Similarity=0.630  Sum_probs=302.8

Q ss_pred             CCCcEEEEeeCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHHhcCCCceEEEEecCC-CCcccCCChhhHHHhhccCChH
Q 015820           32 LCNQVLVEGKANSRMAILNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSG-RAFCAGGDIVSLYHFMNQGKLE  110 (399)
Q Consensus        32 ~~~~v~~~~~~~v~~Itlnrp~~~Nal~~~~~~eL~~~l~~~~~d~~v~~vVltg~g-~~F~aG~Dl~~~~~~~~~~~~~  110 (399)
                      .++.|.++++|+|++||||||+++|+||.+|+.+|.++|+.++.|++||+|||||.| ++||+|+|++++.... ..+..
T Consensus         7 ~~e~vl~e~~~~Va~itLnrP~~~NAl~~~m~~~l~~al~~~~~d~~vr~vvltg~G~~~FcaG~Dl~~~~~~~-~~~~~   85 (353)
T 4hdt_A            7 KNEDVLVNVEGGVGLLTLNRPKAINSLTHGMVTTMAERLAAWENDDSVRAVLLTGAGERGLCAGGDVVAIYHSA-KADGA   85 (353)
T ss_dssp             -CCSEEEEEETTEEEEEECCGGGTTCBCHHHHHHHHHHHHHHHTCTTCCEEEEEESSSSBSBCCBCHHHHHHHH-HTTSH
T ss_pred             CCCcEEEEEECCEEEEEEcCCCccCCCCHHHHHHHHHHHHHHHhCCCceEEEEEeCCCCCEecCcCHHHHhhcc-chhhH
Confidence            457899999999999999999999999999999999999999999999999999999 7999999999987543 22344


Q ss_pred             HHHHHHHHHHHHHHHHccCCCcEEEEEcceeecccccccccCCeEEEeCceEEeccccccCccCCCchhHHHhhcchHHH
Q 015820          111 ECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHLG  190 (399)
Q Consensus       111 ~~~~~~~~~~~l~~~i~~~~kP~IAav~G~a~GgG~~Lal~cD~ria~~~a~f~~pe~~~Gl~p~~g~~~~L~r~~g~~a  190 (399)
                      ....++...+.++..+.++||||||+|||+|+|||++|+++||+||++++++|++||+++|++|++|++++|+|++|..+
T Consensus        86 ~~~~~~~~~~~~~~~i~~~~kPvIAav~G~a~GgG~~lal~cD~ria~~~a~f~~pe~~iGl~p~~g~~~~l~rl~g~~a  165 (353)
T 4hdt_A           86 EARRFWFDEYRLNAHIGRYPKPYVSIMDGIVMGGGVGVGAHGNVRVVTDTTKMAMPEVGIGFIPDVGGTYLLSRAPGKLG  165 (353)
T ss_dssp             HHHHHHHHHHHHHHHHHHCSSCEEEEECBEEETHHHHHHTTSSEEEECTTCEEECCGGGGTCCCCTTHHHHHHTSSTTHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEeECceeecCccccCCcCeeccchhccccCcccccccCCCccceehhhhhhhHHH
Confidence            56677788889999999999999999999999999999999999999999999999999999999999999999999669


Q ss_pred             HHHHHcCCCCCHHHHHHcCccceecCCCChhHHHHHHhhhcCCChHHHHHHHHHhccccCCCcchhhhHHHHHHhhcCCC
Q 015820          191 EFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLD  270 (399)
Q Consensus       191 ~~l~ltG~~i~A~eA~~~GLv~~vv~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~f~~~  270 (399)
                      ++|+|||++|+|+||+++||||+|||++++++...++..      +.+...+..+....  ....+......|++||+.+
T Consensus       166 ~~l~ltG~~i~A~eA~~~GLv~~vv~~~~l~~~a~~la~------~~~~~~l~~~~~~~--~~~~l~~~~~~i~~~f~~~  237 (353)
T 4hdt_A          166 LHAALTGAPFSGADAIVMGFADHYVPHDKIDEFTRAVIA------DGVDAALAAHAQEP--PASPLAEQRSWIDECYTGD  237 (353)
T ss_dssp             HHHHHHCCCBCHHHHHHHTSCSEECCGGGHHHHHHHHHH------HCHHHHHHHHCBCC--CCCHHHHTHHHHHHHTTCS
T ss_pred             HHHHhcCCCCCHHHHHHcCCCcEEeCHHHHHHHHHHHHH------hchhHHHHHhcccC--CccchHHHHHHHHHHhCCC
Confidence            999999999999999999999999999999877776642      22344455555433  3345667788999999999


Q ss_pred             CHHHHHHHHHhhhccCCchHHHHHHHHHHhcCchHHHHHHHHHHhcccC-CHHHHHHHHHHHHHHhhccCCCCcHHhhHh
Q 015820          271 TVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQ-TFDECLVREYRMSLQGVSRLISGDFYEGVR  349 (399)
Q Consensus       271 ~~~ei~~~l~~~~~~~~~~~a~~~a~~i~~~~p~a~~~~k~~l~~~~~~-~~~~~l~~e~~~~~~~~~~~~s~d~~egv~  349 (399)
                      ++++|+++|+..    ...|+.+.++.|+++||.|++.+|+.++++... +++++|+.|.+++..++.   ++|++|||+
T Consensus       238 ~~~~i~~~L~~~----~~~~a~~~a~~la~~sP~a~~~~k~~l~~~~~~~sl~e~l~~E~~~~~~~~~---s~D~~EGvr  310 (353)
T 4hdt_A          238 TVADIIAALRAH----DAPAAGEAADLIATRSPIALSVTLESVRRAAKLQSLEDTLRQEYRVSCASLK---SHDLVEGIR  310 (353)
T ss_dssp             SHHHHHHHHHHH----CSHHHHHHHHHHTTSCHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHTT---CHHHHHHHH
T ss_pred             CHHHHHHHHHhc----ccHHHHHHHHHHHhcCcHHHHHHHHHHHHhccCCCHHHHHHHHHHHHHHHhC---CchHHHHHh
Confidence            999999999865    568999999999999999999999999998775 799999999999999887   999999999


Q ss_pred             hhhccCCCCCCCCCCCccCCCHHHHhcccCCCCCCCCCcccChhh
Q 015820          350 ARMVDRDIAPKWSPPSLEQVSEDMVDRYFSPLSESELDLELPTKL  394 (399)
Q Consensus       350 afl~ek~r~p~~~~~~~~~v~~~~v~~~~~~~~~~~~~~~~~~~~  394 (399)
                      |||++|+|+|+|+|+++.+|++++|+.+|.|+++   ||++..|.
T Consensus       311 Afl~dekR~P~w~p~~l~~V~~~~v~~~f~p~~~---el~~~~~~  352 (353)
T 4hdt_A          311 AQLVDKDRNPKWRPATLAEVTEADVEAYFAPVDP---ELTFEGET  352 (353)
T ss_dssp             HHHC----CCCCSSCSGGGCCHHHHHGGGCCCSS---CCCCCCC-
T ss_pred             hhhhCcCCCCCCCCCChhhCCHHHHHHHcCCCCC---CCCCCCcC
Confidence            9998766999999999999999999999999964   46666553
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 399
d1mj3a_260 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat 2e-27
d1uiya_253 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {The 2e-18
d1dcia_275 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 7e-15
d1dcia_275 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 6e-04
d1hzda_266 c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [T 1e-13
d2f6qa1245 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-C 3e-13
d1q52a_297 c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacter 1e-11
d1pjha_266 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 2e-10
d1nzya_269 c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Ps 1e-09
d1wdka4310 c.14.1.3 (A:1-310) Fatty oxidation complex alpha s 2e-08
d2fw2a1258 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Hum 9e-07
d1sg4a1249 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-d 1e-06
d2a7ka1230 c.14.1.3 (A:1-230) Carbapenem biosynthes protein C 2e-05
d1szoa_249 c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus 3e-05
d1wz8a1263 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TT 9e-05
d1ef8a_261 c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Esc 4e-04
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Enoyl-CoA hydratase (crotonase)
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  107 bits (267), Expect = 2e-27
 Identities = 48/162 (29%), Positives = 75/162 (46%), Gaps = 7/162 (4%)

Query: 49  LNRPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGK 108
           LNRP ALNAL   +  +LN+  + +E DP +G + + G  +AF AG DI  + +      
Sbjct: 22  LNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRT---- 77

Query: 109 LEECKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPET 168
                 +     S    +    KP +A +NG  +GGG  +++      A  K  F  PE 
Sbjct: 78  --FQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEI 135

Query: 169 LIGFHPDAGASFYLSHLPGH-LGEFLALTGAKLNGAEMMACG 209
           L+G  P AG +  L+   G  L   + LTG +++  +    G
Sbjct: 136 LLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAG 177
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Length = 253 Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 275 Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 275 Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 297 Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266 Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Length = 269 Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 310 Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Length = 230 Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 249 Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Length = 263 Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Length = 261 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query399
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 100.0
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 100.0
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 100.0
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 100.0
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 100.0
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 100.0
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 100.0
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 100.0
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 100.0
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 100.0
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 100.0
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 98.18
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 98.13
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 98.06
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 97.94
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 97.77
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 97.58
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 97.49
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 97.26
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 97.25
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 97.22
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 97.21
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 96.86
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 96.22
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 96.04
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 95.76
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 95.73
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 94.61
d1uyra1333 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 93.55
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Chromodomain protein CDY2A
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9e-56  Score=417.21  Aligned_cols=256  Identities=20%  Similarity=0.246  Sum_probs=236.0

Q ss_pred             CCcEEEEeeCCEEEEEEc-CCCCCCCCCHHHHHHHHHHHHHHhcCCCceEEEEecCCCCcccCCChhhHHHhhccCChHH
Q 015820           33 CNQVLVEGKANSRMAILN-RPSALNALNTNMGAKLNKLFKAWENDPNIGFVSMKGSGRAFCAGGDIVSLYHFMNQGKLEE  111 (399)
Q Consensus        33 ~~~v~~~~~~~v~~Itln-rp~~~Nal~~~~~~eL~~~l~~~~~d~~v~~vVltg~g~~F~aG~Dl~~~~~~~~~~~~~~  111 (399)
                      |+.|.++++++|++|++| ||+++|++|.+|+.+|.++|+.++.|+ +++|||||.|++||+|+|++++...........
T Consensus         1 y~~i~v~~~~gi~~i~l~~rp~~~Nals~~~~~el~~al~~~~~d~-~~~vvl~g~g~~FsaG~Dl~~~~~~~~~~~~~~   79 (258)
T d2fw2a1           1 YRDIVVKKEDGFTQIVLSTRSTEKNALNTEVIKEMVNALNSAAADD-SKLVLFSAAGSVFCCGLDFGYFVRHLRNDRNTA   79 (258)
T ss_dssp             CCSEEEEEETTEEEEEECCSSSSTTCBCHHHHHHHHHHHHHHHHSS-CSEEEEEECSSCSBCCBCHHHHHHHHHHCHHHH
T ss_pred             CceEEEEEECCEEEEEECCCCcccCCCCHHHHHHHHHHHHHHHcCC-CEEEEEecCccccccccccchhhhcccccccch
Confidence            578999999999999997 799999999999999999999999874 699999999999999999999876543444445


Q ss_pred             HHHHHHHHHHHHHHHccCCCcEEEEEcceeecccccccccCCeEEEeCceEEeccccccCccCCCchhHHHhhcchHH-H
Q 015820          112 CKDFFRTLYSFIYLLGTHLKPHVAILNGVTMGGGAGVSIPGTFRVACGKTVFATPETLIGFHPDAGASFYLSHLPGHL-G  190 (399)
Q Consensus       112 ~~~~~~~~~~l~~~i~~~~kP~IAav~G~a~GgG~~Lal~cD~ria~~~a~f~~pe~~~Gl~p~~g~~~~L~r~~g~~-a  190 (399)
                      ...+...+++++..+.++||||||+|||+|+|||++|+++||+||++++++|++||+++|++|++|++++|++++|.. +
T Consensus        80 ~~~~~~~~~~~~~~i~~~~kP~Iaav~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~Gl~p~~g~~~~l~r~ig~~~a  159 (258)
T d2fw2a1          80 SLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPDGCSSITFPKMMGKASA  159 (258)
T ss_dssp             HHHHHHHHHHHHHHHHHCCSCEEEEECSCEETHHHHTGGGSSEEEEETTCEEECCHHHHTCCCCTTHHHHHHHHHCHHHH
T ss_pred             hhHHHHHHHHHHHhhhccceeeeeecccccccccccccccccccceecccceeeccccccccccccccccchhhcCcccc
Confidence            567788889999999999999999999999999999999999999999999999999999999999999999999999 9


Q ss_pred             HHHHHcCCCCCHHHHHHcCccceecCCCChhHHHHHHhhhcCCChHHHHHHHHHhccccCCCcchhhhHHHHHHhhcCCC
Q 015820          191 EFLALTGAKLNGAEMMACGLATHYSVSEKLPLIEEELGKLVTDDPSVIEACLEKYSDLVYPDKNSVIHRIDIVDKCFGLD  270 (399)
Q Consensus       191 ~~l~ltG~~i~A~eA~~~GLv~~vv~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~f~~~  270 (399)
                      ++|++||++++|++|+++||||+||+++++.+....                                            
T Consensus       160 ~~l~l~g~~~~a~eA~~~Glv~~vv~~~~l~~~a~~--------------------------------------------  195 (258)
T d2fw2a1         160 NEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMI--------------------------------------------  195 (258)
T ss_dssp             HHHHTTCCEEEHHHHHHTTSCSEEECSTTHHHHHHH--------------------------------------------
T ss_pred             chhhccCcccccccccccccccccccccccccccch--------------------------------------------
Confidence            999999999999999999999999999888643332                                            


Q ss_pred             CHHHHHHHHHhhhccCCchHHHHHHHHHHhcCchHHHHHHHHHHhcccCCHHHHHHHHHHHHHHhhccCCCCcHHhhHhh
Q 015820          271 TVEEIIDSLESEASLINDPWCGSTLRLLKEASPLSLKVSLRSIREGRFQTFDECLVREYRMSLQGVSRLISGDFYEGVRA  350 (399)
Q Consensus       271 ~~~ei~~~l~~~~~~~~~~~a~~~a~~i~~~~p~a~~~~k~~l~~~~~~~~~~~l~~e~~~~~~~~~~~~s~d~~egv~a  350 (399)
                                             ++++|++.||.+++.+|++++.....+++++++.|.+.+..++.   ++|++|||+|
T Consensus       196 -----------------------~a~~i~~~~~~a~~~~K~~~~~~~~~~l~~~~~~e~~~~~~~~~---s~d~~Egi~a  249 (258)
T d2fw2a1         196 -----------------------QIKELASYNAIVLEECKALVRCNIKLELEQANERECEVLRKIWS---SAQGIESMLK  249 (258)
T ss_dssp             -----------------------HHHHHTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT---SHHHHHHHHH
T ss_pred             -----------------------hhhhhhhhhHHHHHHHHHHHHHhhcCCHHHHHHHHHHHHHHHhC---CHHHHHHHHH
Confidence                                   38899999999999999999999888899999999999998887   9999999999


Q ss_pred             hhccCCCCCCC
Q 015820          351 RMVDRDIAPKW  361 (399)
Q Consensus       351 fl~ek~r~p~~  361 (399)
                      |+ || |+|+|
T Consensus       250 f~-EK-R~p~f  258 (258)
T d2fw2a1         250 YV-EN-KIDEF  258 (258)
T ss_dssp             HH-HS-SCCCC
T ss_pred             Hh-CC-CCCCC
Confidence            99 99 99998
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure