Citrus Sinensis ID: 015833


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MSLSQWYVQQLRRRMTSTKEIGEEVKVSDLEGKVTALYFSANWYPPCGNFTGVLVDVYEELRNNGSDFEVVFVSSDEDLNAFNNYRACMPWLAVPYSDLETKKALNRKFDIEGIPCLVVLQPYDDKDDATLHDGVELIYKYGIRAFPFTKEKLEELQKEEKEKHERQTLINLLTNHDRGYLLGHPPDEKVPVSSLVGKTVGLYFSARWCIPCEKFMPKLLSIYQKIKQNLVEKGDALEDFEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKELTKYFDVQGIPCLVIIGPEGKTVTKQGRNLINLYQENAYPFTEAKLEFLEKQMEEEAKNLPRSEFHIGHRHELNLVSEGTGGGPFICCDCDEQGSGWAYQCLECGYEVHPKCVRAVDRGSMIQR
ccccHHHHHHHHHHcccccccccCECcccccccEEEEEEECcccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHcccccEECccccHHHHHHHHHHcccccccEEEEEccccccccccccccEEHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccHHHHHHHHccccccECccccccHHHHHHHcccccccEEEEEcccccEEccccHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccCEEEEEcccccccEEccccccccccEEEEcccccccccccccccccccccccc
*****WYV***************EVKVSDLEGKVTALYFSANWYPPCGNFTGVLVDVYEELRNNGSDFEVVFVSSDEDLNAFNNYRACMPWLAVPYSDLETKKALNRKFDIEGIPCLVVLQPYDDKDDATLHDGVELIYKYGIRAFPFTKEKLEELQKEEKEKHERQTLINLLTNHDRGYLLGHPPDEKVPVSSLVGKTVGLYFSARWCIPCEKFMPKLLSIYQKIKQNLVEKGDALEDFEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKELTKYFDVQGIPCLVIIGPEGKTVTKQGRNLINLYQENAYPFTEAKLEFLE**************FHIGHRHELNLVSEGTGGGPFICCDCDEQGSGWAYQCLECGYEVHPKCVRA*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLSQWYVQQLRRRMTSTKEIGEEVKVSDLEGKVTALYFSANWYPPCGNFTGVLVDVYEELRNNGSDFEVVFVSSDEDLNAFNNYRACMPWLAVPYSDLETKKALNRKFDIEGIPCLVVLQPYDDKDDATLHDGVELIYKYGIRAFPFTKEKLEELQKEEKEKHERQTLINLLTNHDRGYLLGHPPDEKVPVSSLVGKTVGLYFSARWCIPCEKFMPKLLSIYQKIKQNLVEKGDALEDFEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKELTKYFDVQGIPCLVIIGPEGKTVTKQGRNLINLYQENAxxxxxxxxxxxxxxxxxxxxxLPRSEFHIGHRHELNLVSEGTGGGPFICCDCDEQGSGWAYQCLECGYEVHPKCVRAVDRGSMIQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable nucleoredoxin 2 Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.probableQ0JIL1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LUS, chain A
Confidence level:very confident
Coverage over the Query: 11-139
View the alignment between query and template
View the model in PyMOL
Template: 1O73, chain A
Confidence level:very confident
Coverage over the Query: 172-306
View the alignment between query and template
View the model in PyMOL
Template: 2L5O, chain A
Confidence level:very confident
Coverage over the Query: 173-337
View the alignment between query and template
View the model in PyMOL
Template: 1V5N, chain A
Confidence level:very confident
Coverage over the Query: 310-394
View the alignment between query and template
View the model in PyMOL
Template: 3UEM, chain A
Confidence level:confident
Coverage over the Query: 32-78,101-250,274-297
View the alignment between query and template
View the model in PyMOL