Citrus Sinensis ID: 015853

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MPESMSISVNGQSQVPPGFRFHPTEEELLHYYLRKKVSSEKIDLDVIRDVDLNKLEPWDIQEKCKIGSTPQSDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIHSNCRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRLDDNPNEITNVSNVMGDATQEESWVVCRIFKKKDHHKTLGSPTSSSINGNRMFNSCNEGSLEQILQHMGGTCKEESDEPNNNLRLYRAILGTGTGGFDHNDPFLKLPSLRSPNSSGSQNNYHHYPMPMVTEIEGSVSNQVSSSNLNNSVYHTETESSSGLTSWAALDRLVASQLNGQTETSRQLACFNEPTMAPYCNPTDDDHQHDFQLPPLRSSSILSSNSSYHGSEDYNNEIDIWNYTRSSSSSDPLCHASNNRL
cccccccccccccccccccccccccHHHHHHHHHHHHcccccccccEEcccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccCEEEEEEEcEEcccccccccccccEEEEcccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccHHHHHHcccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
****************PGFRFHPTEEELLHYYLRKKVSSEKIDLDVIRDVDLNKLEPWDIQEKCKIGSTPQSDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIHSNCRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRLDDN****************EESWVVCRIFKK**************************************************LRLYRAILGTGTGGFDHN*************************************************************SWAALDRLVA*************************************************************EIDIW*Y******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPESMSISVNGQSQVPPGFRFHPTEEELLHYYLRKKVSSEKIDLDVIRDVDLNKLEPWDIQEKCKIGSTPQSDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIHSNCRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRLDDNPNEITNVSNVMGDATQEESWVVCRIFKKKDHHKTLGSPTSSSINGNRMFNSCNEGSLEQILQHMGGTCKEESDEPNNNLRLYRAILGTGTGGFDHNDPFLKLPSLRSPNSSGSQNNYHHYPMPMVTEIEGSVSNQVSSSNLNNSVYHTETESSSGLTSWAALDRLVASQLNGQTETSRQLACFNEPTMAPYCNPTDDDHQHDFQLPPLRSSSILSSNSSYHGSEDYNNEIDIWNYTRSSSSSDPLCHASNNRL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NAC domain-containing protein 43 Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulates the secondary cell wall lignification of other tissues.probableQ84WP6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ULX, chain A
Confidence level:very confident
Coverage over the Query: 9-141,156-176
View the alignment between query and template
View the model in PyMOL