Citrus Sinensis ID: 015878

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40

MKSSPSTTSLGANRNYHSLLGKIPLSSNQNNTLNVNSNSTDIDICNKIEDTHSAFSRLELKQTNELANHAAQNIARRDKVVNAPSLEPESCASGKSNRKLKGLKSTKSGTQGSNADAPNGLNLSNGCRYDSSLGLLTRKFINLIQEAKDGTLDLNRTAEVLEVQKRRIYDITNVLEGIGLIEKTSKNHIRWKGSDSLGTSKLDDQVARLKAEIESLHAEECRIDDSIREKQELIRTLEENENHQKYMFLTEEDIASLPCFQNQTLIAIKAPQASYIEVPDPDEDISFLKRQYKMIIRSTTGPIDVYLLSKYQSEGKDITLQQANSANPSTWNYEPCGVPNFRLSLEHEDNQKRSSDTFSLMSSEAASGIQKIVPSDCDIDDDYWFRSDPEVSITDLWNN

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcHHHHHHHHHccccHHHccccCEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccccccccEEEEEccccccEEEcccccccHccccccEEEEEEcccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*****************************************IDICNKIE*****************************************************************************CRYDSSLGLLTRKFINLIQEAKDGTLDLNRTAEVLEVQKRRIYDITNVLEGIGLIEKTSKNHIRWKGSDSL**********************ECRIDDSIREKQELIRTLEENENHQKYMFLTEEDIASLPCFQNQTLIAIKAPQASYIEVPDPDEDISFLKRQYKMIIRSTTGPIDVYLLSKY**********************************************************QKIVPSDCDIDDDYWFRSDPEVSITDLWNN

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKSSPSTTSLGANRNYHSLLGKIPLSSNQNNTLNVNSNSTDIDICNKIEDTHSAFSRLELKQTNELANHAAQNIARRDKVVNAPSLEPESCASGKSNRKLKGLKSTKSGTQGSNADAPNGLNLSNGCRYDSSLGLLTRKFINLIQEAKDGTLDLNRTAEVLEVQKRRIYDITNVLEGIGLIEKTSKNHIRWKGSDSLGxxxxxxxxxxxxxxxxxxxxxECRxxxxxxxxxxxxxxxxxxxxxQKYMFLTEEDIASLPCFQNQTLIAIKAPQASYIEVPDPDEDISFLKRQYKMIIRSTTGPIDVYLLSKYQSEGKDITLQQANSANPSTWNYEPCGVPNFRLSLEHEDNQKRSSDTFSLMSSEAASGIQKIVPSDCDIDDDYWFRSDPEVSITDLWNN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor E2FC	Involved in transcriptional repression. May act by repressing E2F-regulated genes in mature differentiated cells, but is not an antagonist of E2FA. Restricts cell division and is involved in the coordination between cell proliferation and endoreduplication during development. May play a role during the transition from skotomorphogenesis to photomorphogenesis. Regulated by phosphorylation-dependent proteolysis via the protein-ubiquitin ligase SCF(SKP2A) complex.	probable	Q9FV70

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AZE, chain B
Confidence level:very confident
Coverage over the Query: 204-310
View the alignment between query and template
View the model in PyMOL

Template: 1CF7, chain A
Confidence level:very confident
Coverage over the Query: 127-192
View the alignment between query and template
View the model in PyMOL