Citrus Sinensis ID: 015919


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGDQKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTPV
cHHHHHHHHHHcccccEEEEEEEEEcccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccEEEcccccccEEEEEccccccccEEEcHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccHHHHHHHHHcccEEEcccccHHHHcccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccEEEEEcccccccccccccHHHccccccccccccccccccccccccccccccccEEcccEEEEEEccccccccccHHHHHHHHHHccccccccc
cHHHHHHHHHHHcccccEEEEEEEEEccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEccccccccHHcccccccccccccccEEEEHHHccEEEEEEEEcccccEEEccHHHHHHHHHHHHHcccccccEEEEEcccccccHHEEHHccccccEEEEEEcHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEccccccccccccHHHHHHHHHcccEEccccccccEcccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccEEEEEEccccccEEEcccHEccccccccccccccccccccccccccccccccEcccccEEEEEEccccccccccHHHHHHHHHHccccccccc
MFEQRANEVVLAIPWvnkvnvtmsaqparpifaeQLPEGLQKISNIVAVssckggvgkSTVAVNLAYTLAGMGarvgifdadvygpslptmvspenrllemnpekrtiipteyLGVKLVsfgfsgqgraimrgpmVSGVINQLLTTTEWGELDYlvidmppgtgdiqltlcqvvPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVEnmchfdadgkryypfgrgsgsqvvqqfgiphlfdlpirptlsasgdsgmpevaadpcgevaNTFQDLGVCVVQQCAKIRQQVSTAVIYDKSIKAikvkvpqsdeefflhpatvrrndrsaqsvdewtgdqklqytdvpediepeeirpmgnyavsitwpdgfsqiapydqlqtmerlvdvpqptpv
mfeqranevvlaipwvnkvNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQCAKIRQQVSTAVIYDKSIKAIkvkvpqsdeefflhpatvrrndrsaqsvdewtgdqklqytdvPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMErlvdvpqptpv
MFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGDQKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTPV
*******EVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMV******L****EKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPT************AADPCGEVANTFQDLGVCVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHP***********************************IRPMGNYAVSITWPDGFSQIAPYDQLQ**************
MFE**ANEVVLAIPWVNKVNVTM*********************NIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVS***************IPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQCA*****************A*****PQSDEEFFLHPATVRRNDRSAQSVDEWTGD**L***DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQ****
MFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRN*********WTGDQKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTPV
MFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGDQKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQP***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGDQKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTPV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query398 2.2.26 [Sep-21-2011]
P45135370 Protein mrp homolog OS=Ha yes no 0.605 0.651 0.443 7e-53
P72190287 Uncharacterized ATP-bindi N/A no 0.618 0.857 0.486 5e-52
Q54F15323 Iron-sulfur protein NUBPL yes no 0.635 0.783 0.420 1e-51
P0AF08369 Protein mrp OS=Escherichi N/A no 0.620 0.669 0.440 5e-50
P0AF09369 Protein mrp OS=Escherichi yes no 0.620 0.669 0.440 5e-50
Q9ZMM5368 Protein mrp homolog OS=He yes no 0.603 0.652 0.413 4e-49
O66946364 Protein mrp homolog OS=Aq yes no 0.608 0.664 0.443 4e-49
P53383353 Protein mrp homolog OS=Sy N/A no 0.648 0.730 0.422 1e-48
O24999368 Protein mrp homolog OS=He no no 0.603 0.652 0.409 2e-48
Q9RVM9350 Protein mrp homolog OS=De yes no 0.562 0.64 0.432 4e-44
>sp|P45135|MRP_HAEIN Protein mrp homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mrp PE=3 SV=2 Back     alignment and function desciption
 Score =  208 bits (529), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 151/246 (61%), Gaps = 5/246 (2%)

Query: 39  GLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRL 98
            ++ + NI+AVSS KGGVGKS+V+VNLA  L   GARVGI DAD+YGPS+P M+   ++ 
Sbjct: 102 AVKGVKNIIAVSSGKGGVGKSSVSVNLALALQAQGARVGILDADIYGPSIPHMLGAADQR 161

Query: 99  LEMNPEKRTIIPTEYLGVKLVSFGF--SGQGRAIMRGPMVSGVINQLLTTTEWGELDYLV 156
              +P+ + I P +  G+   S GF  +     I RGPM S  ++QLL  T W  LDYLV
Sbjct: 162 -PTSPDNQHITPIKAHGLSANSIGFLMNEDSATIWRGPMASSALSQLLNETLWDSLDYLV 220

Query: 157 IDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMC- 215
           IDMPPGTGDIQLTL Q +P+T AV+VTTPQ +A +D  KG+ MF ++ VP + +VENM  
Sbjct: 221 IDMPPGTGDIQLTLSQQIPVTGAVVVTTPQDIALLDAVKGISMFERVSVPVLGIVENMSM 280

Query: 216 HFDAD-GKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVAN 274
           H  ++ G     FG G   ++ +++ +  L  LP+   +    D+G P V   P  E++ 
Sbjct: 281 HICSECGHHEAIFGTGGAEKMAEKYNVKVLAQLPLHIRIREDLDAGNPTVVRVPENEISQ 340

Query: 275 TFQDLG 280
            F  L 
Sbjct: 341 AFLQLA 346





Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (taxid: 71421)
>sp|P72190|YCAB_PSEFR Uncharacterized ATP-binding protein in capB 3'region OS=Pseudomonas fragi PE=3 SV=1 Back     alignment and function description
>sp|Q54F15|NUBPL_DICDI Iron-sulfur protein NUBPL OS=Dictyostelium discoideum GN=nubpl PE=3 SV=1 Back     alignment and function description
>sp|P0AF08|MRP_ECOLI Protein mrp OS=Escherichia coli (strain K12) GN=mrp PE=3 SV=1 Back     alignment and function description
>sp|P0AF09|MRP_ECOL6 Protein mrp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mrp PE=3 SV=1 Back     alignment and function description
>sp|Q9ZMM5|MRP_HELPJ Protein mrp homolog OS=Helicobacter pylori (strain J99) GN=mrp PE=3 SV=1 Back     alignment and function description
>sp|O66946|MRP_AQUAE Protein mrp homolog OS=Aquifex aeolicus (strain VF5) GN=mrp PE=3 SV=1 Back     alignment and function description
>sp|P53383|MRP_SYNY3 Protein mrp homolog OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mrp PE=3 SV=1 Back     alignment and function description
>sp|O24999|MRP_HELPY Protein mrp homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=mrp PE=3 SV=2 Back     alignment and function description
>sp|Q9RVM9|MRP_DEIRA Protein mrp homolog OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mrp PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query398
297738859 556 unnamed protein product [Vitis vinifera] 0.997 0.714 0.926 0.0
225445308 525 PREDICTED: protein mrp homolog [Vitis vi 0.997 0.756 0.926 0.0
356531234 530 PREDICTED: protein mrp homolog [Glycine 0.994 0.747 0.906 0.0
356520515 533 PREDICTED: protein mrp homolog [Glycine 0.994 0.742 0.909 0.0
449461963 529 PREDICTED: protein mrp homolog [Cucumis 0.997 0.750 0.891 0.0
388500020 526 unknown [Medicago truncatula] 0.984 0.745 0.900 0.0
15230111 532 ATP binding protein [Arabidopsis thalian 1.0 0.748 0.881 0.0
21592386 532 mrp protein, putative [Arabidopsis thali 1.0 0.748 0.879 0.0
297835526 531 high-chlorophyll-fluorescence 101 [Arabi 1.0 0.749 0.879 0.0
357130844494 PREDICTED: protein mrp homolog [Brachypo 0.992 0.799 0.875 0.0
>gi|297738859|emb|CBI28104.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/397 (92%), Positives = 381/397 (95%)

Query: 1   MFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKST 60
           MFEQ+ANEVV  +PWV  VNVTMSAQPARP+FA QLP GLQ ISNI+AVSSCKGGVGKST
Sbjct: 157 MFEQKANEVVAMLPWVKNVNVTMSAQPARPVFAGQLPAGLQTISNIIAVSSCKGGVGKST 216

Query: 61  VAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKRTIIPTEYLGVKLVS 120
           VAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKR+IIPTEYLGVKLVS
Sbjct: 217 VAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKRSIIPTEYLGVKLVS 276

Query: 121 FGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAV 180
           FGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAV
Sbjct: 277 FGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAV 336

Query: 181 IVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFG 240
           IVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADGKRYYPFGRGSGSQVVQQFG
Sbjct: 337 IVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYPFGRGSGSQVVQQFG 396

Query: 241 IPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQCAKIRQQVSTAVIY 300
           IPHLFDLPIRPTLSASGDSGMPEV ADP GE+A TFQ+LGVCVVQQCAKIRQQVSTAV Y
Sbjct: 397 IPHLFDLPIRPTLSASGDSGMPEVVADPLGEIAQTFQNLGVCVVQQCAKIRQQVSTAVTY 456

Query: 301 DKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGDQKLQYTDVPEDIEPEEIRP 360
           DK IKAI+VKVP S+EEF LHPATVRRNDRSAQSVDEWTG+QKLQY DVPEDIEPEEIRP
Sbjct: 457 DKFIKAIRVKVPDSEEEFLLHPATVRRNDRSAQSVDEWTGEQKLQYADVPEDIEPEEIRP 516

Query: 361 MGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTP 397
           MGNYAVSITWPDGFSQIAPYDQLQT+ERLVDVPQ TP
Sbjct: 517 MGNYAVSITWPDGFSQIAPYDQLQTIERLVDVPQLTP 553




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225445308|ref|XP_002281353.1| PREDICTED: protein mrp homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|356531234|ref|XP_003534183.1| PREDICTED: protein mrp homolog [Glycine max] Back     alignment and taxonomy information
>gi|356520515|ref|XP_003528907.1| PREDICTED: protein mrp homolog [Glycine max] Back     alignment and taxonomy information
>gi|449461963|ref|XP_004148711.1| PREDICTED: protein mrp homolog [Cucumis sativus] gi|449508261|ref|XP_004163266.1| PREDICTED: protein mrp homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|388500020|gb|AFK38076.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|15230111|ref|NP_189086.1| ATP binding protein [Arabidopsis thaliana] gi|40950525|gb|AAR97892.1| [4Fe-4S] cluster assembly factor [Arabidopsis thaliana] gi|110740872|dbj|BAE98532.1| putative mrp protein [Arabidopsis thaliana] gi|332643376|gb|AEE76897.1| ATP binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21592386|gb|AAM64337.1| mrp protein, putative [Arabidopsis thaliana] gi|30502918|emb|CAD90253.1| putative PSI stabilising protein precursor [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297835526|ref|XP_002885645.1| high-chlorophyll-fluorescence 101 [Arabidopsis lyrata subsp. lyrata] gi|297331485|gb|EFH61904.1| high-chlorophyll-fluorescence 101 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357130844|ref|XP_003567054.1| PREDICTED: protein mrp homolog [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query398
TAIR|locus:2087148532 HCF101 "HIGH-CHLOROPHYLL-FLUOR 1.0 0.748 0.881 3.2e-191
UNIPROTKB|Q4K759364 PFL_4843 "Uncharacterized prot 0.660 0.722 0.462 4.8e-55
UNIPROTKB|Q8EDX3371 apbC "Scaffold protein for [4F 0.703 0.754 0.425 7.8e-55
TIGR_CMR|SO_2618371 SO_2618 "ATP-binding protein, 0.703 0.754 0.425 7.8e-55
UNIPROTKB|Q87XN1364 PSPTO_4146 "ParA family protei 0.610 0.667 0.484 2.6e-54
UNIPROTKB|Q48LT6364 PSPPH_1379 "ATP-binding protei 0.613 0.670 0.469 2.4e-53
UNIPROTKB|Q480H6391 CPS_2838 "Putative mrp protein 0.605 0.616 0.463 3.8e-53
TIGR_CMR|CPS_2838391 CPS_2838 "putative mrp protein 0.605 0.616 0.463 3.8e-53
UNIPROTKB|Q0C4Z5410 HNE_0468 "Putative uncharacter 0.645 0.626 0.430 1.1e-50
UNIPROTKB|Q60CU7361 MCA0052 "MrP protein" [Methylo 0.640 0.706 0.433 4.6e-50
TAIR|locus:2087148 HCF101 "HIGH-CHLOROPHYLL-FLUORESCENCE 101" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1853 (657.3 bits), Expect = 3.2e-191, P = 3.2e-191
 Identities = 351/398 (88%), Positives = 376/398 (94%)

Query:     1 MFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKST 60
             MFE +ANEVV A+PWV KVNVTMSAQPA+PIFA QLP GL +ISNI+AVSSCKGGVGKST
Sbjct:   133 MFENKANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKST 192

Query:    61 VAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEKRTIIPTEYLGVKLVS 120
             VAVNLAYTLAGMGARVGIFDADVYGPSLPTMV+PE+R+LEMNPEK+TIIPTEY+GVKLVS
Sbjct:   193 VAVNLAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEMNPEKKTIIPTEYMGVKLVS 252

Query:   121 FGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAV 180
             FGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQV PLTAAV
Sbjct:   253 FGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVAPLTAAV 312

Query:   181 IVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFG 240
             IVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADGKRYYPFG+GSGS+VV+QFG
Sbjct:   313 IVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYPFGKGSGSEVVKQFG 372

Query:   241 IPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQCAKIRQQVSTAVIY 300
             IPHLFDLPIRPTLSASGDSG PEV +DP  +VA TFQDLGVCVVQQCAKIRQQVSTAV Y
Sbjct:   373 IPHLFDLPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGVCVVQQCAKIRQQVSTAVTY 432

Query:   301 DKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGDQKLQYTDVPEDIEPEEIRP 360
             DK +KAI+VKVP SDEEF LHPATVRRNDRSAQSVDEWTG+QK+ Y DV EDIEPE+IRP
Sbjct:   433 DKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGEQKVLYGDVAEDIEPEDIRP 492

Query:   361 MGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTPV 398
             MGNYAVSITWPDGFSQIAPYDQL+ +ERLVDVP  +PV
Sbjct:   493 MGNYAVSITWPDGFSQIAPYDQLEEIERLVDVPPLSPV 530




GO:0005524 "ATP binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016226 "iron-sulfur cluster assembly" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0015979 "photosynthesis" evidence=RCA
GO:0015995 "chlorophyll biosynthetic process" evidence=RCA
GO:0016117 "carotenoid biosynthetic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0034660 "ncRNA metabolic process" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
UNIPROTKB|Q4K759 PFL_4843 "Uncharacterized protein" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EDX3 apbC "Scaffold protein for [4Fe-4S] cluster assembly ApbC" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2618 SO_2618 "ATP-binding protein, Mrp/Nbp35 family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q87XN1 PSPTO_4146 "ParA family protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|Q48LT6 PSPPH_1379 "ATP-binding protein, Mrp/Nbp35 family" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q480H6 CPS_2838 "Putative mrp protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2838 CPS_2838 "putative mrp protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C4Z5 HNE_0468 "Putative uncharacterized protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|Q60CU7 MCA0052 "MrP protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query398
cd02037169 cd02037, MRP-like, MRP (Multiple Resistance and pH 2e-85
PRK11670369 PRK11670, PRK11670, antiporter inner membrane prot 4e-78
COG0489265 COG0489, Mrp, ATPases involved in chromosome parti 3e-59
pfam1060981 pfam10609, ParA, ParA/MinD ATPase like 7e-40
COG0455262 COG0455, flhG, Antiactivator of flagellar biosynth 2e-18
pfam01656217 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide bi 7e-15
cd03110179 cd03110, Fer4_NifH_child, This protein family's fu 2e-14
COG1192259 COG1192, Soj, ATPases involved in chromosome parti 1e-13
cd02038139 cd02038, FleN-like, FleN is a member of the Fer4_N 1e-12
COG1149284 COG1149, COG1149, MinD superfamily P-loop ATPase c 5e-12
cd02042104 cd02042, ParA, ParA and ParB of Caulobacter cresce 4e-11
TIGR01969251 TIGR01969, minD_arch, cell division ATPase MinD, a 3e-10
cd02035217 cd02035, ArsA, ArsA ATPase functionas as an efflux 2e-09
CHL00175281 CHL00175, minD, septum-site determining protein; V 2e-09
TIGR01968261 TIGR01968, minD_bact, septum site-determining prot 4e-09
cd02036179 cd02036, MinD, Bacterial cell division requires th 1e-08
cd0198399 cd01983, Fer4_NifH, The Fer4_NifH superfamily cont 4e-08
pfam13614145 pfam13614, AAA_31, AAA domain 8e-08
cd02034116 cd02034, CooC, The accessory protein CooC, which c 3e-07
cd03111106 cd03111, CpaE_like, This protein family consists o 3e-07
TIGR03018207 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEP- 1e-06
pfam0615587 pfam06155, DUF971, Protein of unknown function (DU 6e-06
PHA02518211 PHA02518, PHA02518, ParA-like protein; Provisional 2e-05
COG2894272 COG2894, MinD, Septum formation inhibitor-activati 2e-05
cd0198399 cd01983, Fer4_NifH, The Fer4_NifH superfamily cont 5e-05
pfam09140262 pfam09140, MipZ, ATPase MipZ 1e-04
COG0003322 COG0003, ArsA, Predicted ATPase involved in chromo 4e-04
TIGR01007204 TIGR01007, eps_fam, capsular exopolysaccharide fam 4e-04
TIGR01005754 TIGR01005, eps_transp_fam, exopolysaccharide trans 5e-04
PRK13705388 PRK13705, PRK13705, plasmid-partitioning protein S 7e-04
cd02038139 cd02038, FleN-like, FleN is a member of the Fer4_N 0.001
cd02040270 cd02040, NifH, NifH gene encodes component II (iro 0.001
COG1348278 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [ 0.001
cd02117212 cd02117, NifH_like, This family contains the NifH 0.002
TIGR03453387 TIGR03453, partition_RepA, plasmid partitioning pr 0.002
PRK13869405 PRK13869, PRK13869, plasmid-partitioning protein R 0.002
pfam07015231 pfam07015, VirC1, VirC1 protein 0.002
PRK13849231 PRK13849, PRK13849, putative crown gall tumor prot 0.003
TIGR03371246 TIGR03371, cellulose_yhjQ, cellulose synthase oper 0.004
>gnl|CDD|238994 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
 Score =  257 bits (658), Expect = 2e-85
 Identities = 96/208 (46%), Positives = 122/208 (58%), Gaps = 41/208 (19%)

Query: 46  IVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMNPEK 105
           ++AV S KGGVGKSTVAVNLA  LA +G +VG+ DAD+YGPS+P M              
Sbjct: 1   VIAVMSGKGGVGKSTVAVNLALALAKLGYKVGLLDADIYGPSIPKMW------------- 47

Query: 106 RTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD 165
                                     RGPM  G I Q LT  +WGELDYLVIDMPPGTGD
Sbjct: 48  --------------------------RGPMKMGAIKQFLTDVDWGELDYLVIDMPPGTGD 81

Query: 166 IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHF--DADGKR 223
             LTL Q +P+  AVIVTTPQ++A  DV K + MF K+ +P + VVENM +F     GK+
Sbjct: 82  EHLTLAQSLPIDGAVIVTTPQEVALDDVRKAIDMFKKVNIPILGVVENMSYFVCPHCGKK 141

Query: 224 YYPFGRGSGSQVVQQFGIPHLFDLPIRP 251
            Y FG+G G ++ ++ G+P L  +P+ P
Sbjct: 142 IYIFGKGGGEKLAEELGVPLLGKIPLDP 169


Like the other members of the superfamily, MRP contains a ATP-binding domain at the N-termini. It is found in bacteria as a membrane-spanning protein and functions as a Na+/H+ antiporter. Length = 169

>gnl|CDD|183270 PRK11670, PRK11670, antiporter inner membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|223563 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|204531 pfam10609, ParA, ParA/MinD ATPase like Back     alignment and domain information
>gnl|CDD|223531 COG0455, flhG, Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>gnl|CDD|216631 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>gnl|CDD|239384 cd03110, Fer4_NifH_child, This protein family's function is unkown Back     alignment and domain information
>gnl|CDD|224113 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|238995 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|238997 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>gnl|CDD|131024 TIGR01969, minD_arch, cell division ATPase MinD, archaeal Back     alignment and domain information
>gnl|CDD|238992 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>gnl|CDD|214385 CHL00175, minD, septum-site determining protein; Validated Back     alignment and domain information
>gnl|CDD|131023 TIGR01968, minD_bact, septum site-determining protein MinD Back     alignment and domain information
>gnl|CDD|238993 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>gnl|CDD|222264 pfam13614, AAA_31, AAA domain Back     alignment and domain information
>gnl|CDD|238991 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>gnl|CDD|239385 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>gnl|CDD|132063 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEP-CTERM locus tyrosine autokinase Back     alignment and domain information
>gnl|CDD|218914 pfam06155, DUF971, Protein of unknown function (DUF971) Back     alignment and domain information
>gnl|CDD|222854 PHA02518, PHA02518, ParA-like protein; Provisional Back     alignment and domain information
>gnl|CDD|225447 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>gnl|CDD|220125 pfam09140, MipZ, ATPase MipZ Back     alignment and domain information
>gnl|CDD|223082 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|130080 TIGR01007, eps_fam, capsular exopolysaccharide family Back     alignment and domain information
>gnl|CDD|130078 TIGR01005, eps_transp_fam, exopolysaccharide transport protein family Back     alignment and domain information
>gnl|CDD|184261 PRK13705, PRK13705, plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>gnl|CDD|238995 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>gnl|CDD|238996 cd02040, NifH, NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>gnl|CDD|224267 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|239034 cd02117, NifH_like, This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>gnl|CDD|234215 TIGR03453, partition_RepA, plasmid partitioning protein RepA Back     alignment and domain information
>gnl|CDD|139929 PRK13869, PRK13869, plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>gnl|CDD|148565 pfam07015, VirC1, VirC1 protein Back     alignment and domain information
>gnl|CDD|139909 PRK13849, PRK13849, putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>gnl|CDD|234188 TIGR03371, cellulose_yhjQ, cellulose synthase operon protein YhjQ Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 398
PRK11670369 antiporter inner membrane protein; Provisional 100.0
KOG3022300 consensus Predicted ATPase, nucleotide-binding [Ce 100.0
CHL00175281 minD septum-site determining protein; Validated 100.0
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 100.0
PRK13232273 nifH nitrogenase reductase; Reviewed 100.0
PRK13235274 nifH nitrogenase reductase; Reviewed 100.0
PRK13233275 nifH nitrogenase reductase; Reviewed 100.0
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 100.0
COG2894272 MinD Septum formation inhibitor-activating ATPase 100.0
CHL00072290 chlL photochlorophyllide reductase subunit L 100.0
PRK13236296 nitrogenase reductase; Reviewed 100.0
cd02040270 NifH NifH gene encodes component II (iron protein) 100.0
PRK13234295 nifH nitrogenase reductase; Reviewed 100.0
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 100.0
PRK13230279 nitrogenase reductase-like protein; Reviewed 100.0
PRK10818270 cell division inhibitor MinD; Provisional 100.0
TIGR01968261 minD_bact septum site-determining protein MinD. Th 100.0
PRK13869405 plasmid-partitioning protein RepA; Provisional 100.0
PRK10037250 cell division protein; Provisional 100.0
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, 100.0
TIGR01287275 nifH nitrogenase iron protein. This model describe 100.0
PRK13231264 nitrogenase reductase-like protein; Reviewed 100.0
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 100.0
COG1192259 Soj ATPases involved in chromosome partitioning [C 100.0
cd02032267 Bchl_like This family of proteins contains bchL an 100.0
PRK13705388 plasmid-partitioning protein SopA; Provisional 99.98
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 99.97
PHA02518211 ParA-like protein; Provisional 99.97
PHA02519387 plasmid partition protein SopA; Reviewed 99.97
TIGR03453387 partition_RepA plasmid partitioning protein RepA. 99.97
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 99.97
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 99.97
cd02117212 NifH_like This family contains the NifH (iron prot 99.96
cd02036179 MinD Bacterial cell division requires the formatio 99.96
PF0615589 DUF971: Protein of unknown function (DUF971); Inte 99.96
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 99.95
COG0489265 Mrp ATPases involved in chromosome partitioning [C 99.95
COG1149284 MinD superfamily P-loop ATPase containing an inser 99.95
cd02033329 BchX Chlorophyllide reductase converts chlorophyll 99.95
PRK13849231 putative crown gall tumor protein VirC1; Provision 99.94
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 99.93
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 99.93
cd03110179 Fer4_NifH_child This protein family's function is 99.93
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 99.93
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 99.91
TIGR03029274 EpsG chain length determinant protein tyrosine kin 99.91
COG1348278 NifH Nitrogenase subunit NifH (ATPase) [Inorganic 99.9
PF00142273 Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot 99.89
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intr 99.89
cd03111106 CpaE_like This protein family consists of proteins 99.88
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 99.87
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 99.87
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 99.85
PRK09841726 cryptic autophosphorylating protein tyrosine kinas 99.84
PRK11519719 tyrosine kinase; Provisional 99.84
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 99.84
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 99.83
PF09140261 MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi 99.82
COG3536120 Uncharacterized protein conserved in bacteria [Fun 99.81
TIGR02409 366 carnitine_bodg gamma-butyrobetaine hydroxylase. Me 99.8
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 99.8
PF13614157 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ 99.76
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 99.73
TIGR02410 362 carnitine_TMLD trimethyllysine dioxygenase. Member 99.72
KOG3888 407 consensus Gamma-butyrobetaine,2-oxoglutarate dioxy 99.68
COG0003322 ArsA Predicted ATPase involved in chromosome parti 99.63
KOG3889 371 consensus Predicted gamma-butyrobetaine,2-oxogluta 99.62
cd03114148 ArgK-like The function of this protein family is u 99.54
TIGR00064272 ftsY signal recognition particle-docking protein F 99.48
KOG2825323 consensus Putative arsenite-translocating ATPase [ 99.47
cd02034116 CooC The accessory protein CooC, which contains a 99.46
PRK13886241 conjugal transfer protein TraL; Provisional 99.45
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 99.41
PRK10867433 signal recognition particle protein; Provisional 99.36
cd03115173 SRP The signal recognition particle (SRP) mediates 99.34
PRK00090222 bioD dithiobiotin synthetase; Reviewed 99.33
PF1060981 ParA: ParA/MinD ATPase like; InterPro: IPR019591 T 99.3
PRK10416318 signal recognition particle-docking protein FtsY; 99.28
TIGR00347166 bioD dethiobiotin synthase. Dethiobiotin synthase 99.28
TIGR00959428 ffh signal recognition particle protein. This mode 99.27
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 99.25
PRK13768253 GTPase; Provisional 99.25
PRK00771437 signal recognition particle protein Srp54; Provisi 99.21
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 99.21
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 99.18
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 99.12
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penulti 99.11
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 99.09
TIGR00345284 arsA arsenite-activated ATPase (arsA). The N-termi 99.07
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 99.02
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 99.01
PRK12374231 putative dithiobiotin synthetase; Provisional 99.01
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 99.0
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 98.99
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 98.95
PRK14974336 cell division protein FtsY; Provisional 98.94
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 98.91
PRK05632 684 phosphate acetyltransferase; Reviewed 98.86
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.84
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 98.83
PF13500199 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R 98.8
TIGR00313 475 cobQ cobyric acid synthase CobQ. 98.8
PRK00784 488 cobyric acid synthase; Provisional 98.8
PRK09435332 membrane ATPase/protein kinase; Provisional 98.76
PRK13505557 formate--tetrahydrofolate ligase; Provisional 98.73
TIGR00379 449 cobB cobyrinic acid a,c-diamide synthase. This mod 98.62
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 98.61
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 98.59
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 98.59
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 98.54
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.44
COG0552340 FtsY Signal recognition particle GTPase [Intracell 98.39
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 98.39
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 98.36
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.25
PRK06278476 cobyrinic acid a,c-diamide synthase; Validated 98.13
KOG0780483 consensus Signal recognition particle, subunit Srp 98.06
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.99
KOG0781587 consensus Signal recognition particle receptor, al 97.93
PRK13896 433 cobyrinic acid a,c-diamide synthase; Provisional 97.93
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 97.9
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 97.89
COG1341398 Predicted GTPase or GTP-binding protein [General f 97.83
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 97.8
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 97.75
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 97.69
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 97.65
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 97.63
PRK14495452 putative molybdopterin-guanine dinucleotide biosyn 97.54
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.49
COG1492 486 CobQ Cobyric acid synthase [Coenzyme metabolism] 97.46
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 97.46
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 97.42
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.26
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 97.24
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 97.21
PF0615589 DUF971: Protein of unknown function (DUF971); Inte 97.16
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 97.15
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.14
cd03116159 MobB Molybdenum is an essential trace element in t 97.13
PLN02974 817 adenosylmethionine-8-amino-7-oxononanoate transami 97.07
PRK12740 668 elongation factor G; Reviewed 97.06
cd00477 524 FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca 97.04
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.99
COG0857354 Pta BioD-like N-terminal domain of phosphotransace 96.94
PRK00889175 adenylylsulfate kinase; Provisional 96.94
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 96.92
PRK00652325 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 96.85
PRK00741 526 prfC peptide chain release factor 3; Provisional 96.85
PRK13506 578 formate--tetrahydrofolate ligase; Provisional 96.84
cd01394218 radB RadB. The archaeal protein radB shares simila 96.82
cd00881189 GTP_translation_factor GTP translation factor fami 96.81
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 96.81
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 96.77
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 96.76
PRK07667193 uridine kinase; Provisional 96.76
PRK05973237 replicative DNA helicase; Provisional 96.75
KOG1533290 consensus Predicted GTPase [General function predi 96.73
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 96.72
PRK07952244 DNA replication protein DnaC; Validated 96.72
PRK03846198 adenylylsulfate kinase; Provisional 96.69
PRK04296190 thymidine kinase; Provisional 96.69
TIGR00503 527 prfC peptide chain release factor 3. This translat 96.67
PRK10218 607 GTP-binding protein; Provisional 96.61
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 96.6
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 96.59
PRK00007 693 elongation factor G; Reviewed 96.59
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 96.56
PF07755301 DUF1611: Protein of unknown function (DUF1611); In 96.55
PRK00093 435 GTP-binding protein Der; Reviewed 96.53
PRK06696223 uridine kinase; Validated 96.53
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 96.53
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.52
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 96.51
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 96.49
PRK00049396 elongation factor Tu; Reviewed 96.39
PRK08233182 hypothetical protein; Provisional 96.38
PRK14491 597 putative bifunctional molybdopterin-guanine dinucl 96.34
smart00382148 AAA ATPases associated with a variety of cellular 96.34
PRK00089292 era GTPase Era; Reviewed 96.33
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 96.33
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 96.29
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.29
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.28
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.26
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 96.21
PRK12739 691 elongation factor G; Reviewed 96.21
TIGR00682311 lpxK tetraacyldisaccharide 4'-kinase. Also called 96.19
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 96.19
PRK13351 687 elongation factor G; Reviewed 96.18
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 96.18
COG0050394 TufB GTPases - translation elongation factors [Tra 96.18
cd03113255 CTGs CTP synthetase (CTPs) is a two-domain protein 96.18
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 96.17
cd01393226 recA_like RecA is a bacterial enzyme which has rol 96.17
PF13479213 AAA_24: AAA domain 96.13
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 96.11
cd04171164 SelB SelB subfamily. SelB is an elongation factor 96.09
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 96.0
PTZ00141 446 elongation factor 1- alpha; Provisional 95.98
PRK15453290 phosphoribulokinase; Provisional 95.96
PRK05480209 uridine/cytidine kinase; Provisional 95.95
PHA02542473 41 41 helicase; Provisional 95.95
PRK06762166 hypothetical protein; Provisional 95.95
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 95.93
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.88
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 95.87
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 95.86
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 95.86
KOG1534273 consensus Putative transcription factor FET5 [Tran 95.86
PLN03127447 Elongation factor Tu; Provisional 95.83
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 95.82
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 95.8
PHA00729226 NTP-binding motif containing protein 95.74
PLN03126478 Elongation factor Tu; Provisional 95.71
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 95.7
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.69
PRK05439311 pantothenate kinase; Provisional 95.67
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.67
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 95.65
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 95.63
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 95.63
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 95.6
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 95.6
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 95.56
PF1324576 AAA_19: Part of AAA domain 95.54
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 95.49
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 95.47
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 95.45
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.44
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.42
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.42
PF13173128 AAA_14: AAA domain 95.4
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 95.39
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.37
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 95.35
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.35
PRK12736394 elongation factor Tu; Reviewed 95.35
TIGR00436270 era GTP-binding protein Era. Era is an essential G 95.33
cd00154159 Rab Rab family. Rab GTPases form the largest famil 95.32
PRK01906338 tetraacyldisaccharide 4'-kinase; Provisional 95.31
TIGR00485394 EF-Tu translation elongation factor TU. This align 95.3
PRK06526254 transposase; Provisional 95.29
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 95.29
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 95.28
COG1663336 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell env 95.23
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 95.23
COG3367339 Uncharacterized conserved protein [Function unknow 95.17
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 95.17
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 95.15
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 95.15
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 95.12
PRK05306 787 infB translation initiation factor IF-2; Validated 95.12
PRK08533230 flagellar accessory protein FlaH; Reviewed 95.11
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 95.11
PF02606326 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr 95.03
COG2403449 Predicted GTPase [General function prediction only 95.01
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 95.0
PRK05433 600 GTP-binding protein LepA; Provisional 94.98
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 94.96
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 94.96
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 94.95
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 94.94
PRK15494339 era GTPase Era; Provisional 94.94
PRK05541176 adenylylsulfate kinase; Provisional 94.92
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 94.9
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 94.88
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 94.88
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 94.87
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 94.85
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 94.8
CHL00071409 tufA elongation factor Tu 94.78
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.76
PTZ00133182 ADP-ribosylation factor; Provisional 94.74
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 94.72
PF00154322 RecA: recA bacterial DNA recombination protein; In 94.7
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.69
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 94.67
PRK07933213 thymidylate kinase; Validated 94.66
PRK09302 509 circadian clock protein KaiC; Reviewed 94.66
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 94.64
PLN02924220 thymidylate kinase 94.64
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 94.61
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 94.59
PRK09183259 transposase/IS protein; Provisional 94.58
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 94.58
PLN00043 447 elongation factor 1-alpha; Provisional 94.57
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.56
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.53
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 94.53
PRK06067234 flagellar accessory protein FlaH; Validated 94.51
PLN03118211 Rab family protein; Provisional 94.49
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.49
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 94.47
KOG2749415 consensus mRNA cleavage and polyadenylation factor 94.45
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 94.45
COG4240300 Predicted kinase [General function prediction only 94.45
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 94.39
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 94.35
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 94.31
PRK12735396 elongation factor Tu; Reviewed 94.31
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.29
cd03112158 CobW_like The function of this protein family is u 94.27
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 94.24
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 94.22
cd00876160 Ras Ras family. The Ras family of the Ras superfam 94.2
PTZ00416 836 elongation factor 2; Provisional 94.16
smart00178184 SAR Sar1p-like members of the Ras-family of small 94.13
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 94.11
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 94.1
PRK06217183 hypothetical protein; Validated 94.1
PRK03003 472 GTP-binding protein Der; Reviewed 94.08
PRK06835329 DNA replication protein DnaC; Validated 94.07
PRK12377248 putative replication protein; Provisional 94.07
PRK09270229 nucleoside triphosphate hydrolase domain-containin 94.05
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 93.99
TIGR03172232 probable selenium-dependent hydroxylase accessory 93.98
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 93.97
PRK08118167 topology modulation protein; Reviewed 93.93
PRK05595444 replicative DNA helicase; Provisional 93.92
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 93.86
COG4088261 Predicted nucleotide kinase [Nucleotide transport 93.85
PRK05380 533 pyrG CTP synthetase; Validated 93.84
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 93.81
KOG3888 407 consensus Gamma-butyrobetaine,2-oxoglutarate dioxy 93.8
cd04123162 Rab21 Rab21 subfamily. The localization and functi 93.8
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 93.8
PRK11823446 DNA repair protein RadA; Provisional 93.79
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 93.78
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 93.77
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 93.76
PRK05642234 DNA replication initiation factor; Validated 93.73
PRK08727233 hypothetical protein; Validated 93.71
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 93.7
PRK08506472 replicative DNA helicase; Provisional 93.69
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 93.69
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 93.68
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 93.63
PRK08760476 replicative DNA helicase; Provisional 93.63
PLN00223181 ADP-ribosylation factor; Provisional 93.61
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 93.61
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 93.6
PRK09354349 recA recombinase A; Provisional 93.6
PLN00116 843 translation elongation factor EF-2 subunit; Provis 93.58
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 93.56
PRK12317425 elongation factor 1-alpha; Reviewed 93.55
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 93.54
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 93.52
PRK00131175 aroK shikimate kinase; Reviewed 93.51
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 93.5
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 93.49
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 93.47
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.4
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 93.39
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 93.39
PRK08939306 primosomal protein DnaI; Reviewed 93.38
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 93.34
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 93.3
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 93.3
PLN02796347 D-glycerate 3-kinase 93.3
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 93.27
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 93.26
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.25
PRK00093435 GTP-binding protein Der; Reviewed 93.23
PLN03108210 Rab family protein; Provisional 93.23
CHL00189 742 infB translation initiation factor 2; Provisional 93.22
PRK08903227 DnaA regulatory inactivator Hda; Validated 93.21
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 93.21
PLN03046460 D-glycerate 3-kinase; Provisional 93.2
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 93.19
cd01878204 HflX HflX subfamily. A distinct conserved domain w 93.19
PRK08181269 transposase; Validated 93.16
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 93.16
PRK06749428 replicative DNA helicase; Provisional 93.01
PF05729166 NACHT: NACHT domain 93.01
PF12846304 AAA_10: AAA-like domain 92.97
PRK08116268 hypothetical protein; Validated 92.93
PRK06547172 hypothetical protein; Provisional 92.87
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 92.87
PRK07261171 topology modulation protein; Provisional 92.83
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 92.79
TIGR00665434 DnaB replicative DNA helicase. This model describe 92.72
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 92.67
PRK06761282 hypothetical protein; Provisional 92.66
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 92.66
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 92.62
PRK07560 731 elongation factor EF-2; Reviewed 92.58
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 92.58
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 92.57
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 92.53
PRK06893229 DNA replication initiation factor; Validated 92.35
PRK03731171 aroL shikimate kinase II; Reviewed 92.34
PRK08006471 replicative DNA helicase; Provisional 92.29
PRK04328249 hypothetical protein; Provisional 92.23
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 92.23
COG1159298 Era GTPase [General function prediction only] 92.22
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 92.2
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 92.2
PTZ00035337 Rad51 protein; Provisional 92.19
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 92.11
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 92.11
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 92.02
PRK04040188 adenylate kinase; Provisional 92.02
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 91.99
PRK05748448 replicative DNA helicase; Provisional 91.98
COG0703172 AroK Shikimate kinase [Amino acid transport and me 91.91
PRK06921266 hypothetical protein; Provisional 91.86
PRK06904472 replicative DNA helicase; Validated 91.79
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 91.78
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 91.78
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 91.78
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 91.78
PRK08084235 DNA replication initiation factor; Provisional 91.75
PRK08840464 replicative DNA helicase; Provisional 91.68
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 91.63
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 91.62
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 91.58
PLN00023334 GTP-binding protein; Provisional 91.58
PRK00698205 tmk thymidylate kinase; Validated 91.56
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 91.52
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 91.36
COG1855604 ATPase (PilT family) [General function prediction 91.33
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 91.29
TIGR00337 525 PyrG CTP synthase. CTP synthase is involved in pyr 91.27
KOG0460449 consensus Mitochondrial translation elongation fac 91.26
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 91.25
PRK06321472 replicative DNA helicase; Provisional 91.19
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 91.15
PRK13947171 shikimate kinase; Provisional 91.09
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 91.08
PTZ00301210 uridine kinase; Provisional 91.08
PLN03071219 GTP-binding nuclear protein Ran; Provisional 91.04
PLN03186342 DNA repair protein RAD51 homolog; Provisional 91.04
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 91.02
COG1160 444 Predicted GTPases [General function prediction onl 90.99
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 90.97
PLN02348395 phosphoribulokinase 90.88
PRK13946184 shikimate kinase; Provisional 90.83
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 90.83
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 90.7
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 90.69
PRK00081194 coaE dephospho-CoA kinase; Reviewed 90.67
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 90.62
COG0504 533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 90.6
PRK09165497 replicative DNA helicase; Provisional 90.59
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 90.59
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 90.58
PRK05636505 replicative DNA helicase; Provisional 90.55
PLN03210 1153 Resistant to P. syringae 6; Provisional 90.54
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 90.54
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 90.53
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 90.51
PRK04220301 2-phosphoglycerate kinase; Provisional 90.41
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 90.32
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 90.24
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 90.2
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 90.2
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 90.16
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 90.04
PRK06851367 hypothetical protein; Provisional 90.01
PRK13695174 putative NTPase; Provisional 89.99
PRK12339197 2-phosphoglycerate kinase; Provisional 89.83
TIGR02236310 recomb_radA DNA repair and recombination protein R 89.79
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 89.7
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 89.44
PRK04301317 radA DNA repair and recombination protein RadA; Va 89.35
PLN02748468 tRNA dimethylallyltransferase 89.33
PLN02327 557 CTP synthase 89.33
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 89.26
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 89.25
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 89.24
PF06418276 CTP_synth_N: CTP synthase N-terminus; InterPro: IP 89.24
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 89.13
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 89.12
PRK07004460 replicative DNA helicase; Provisional 89.11
PRK13975196 thymidylate kinase; Provisional 89.11
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 89.01
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 88.95
PRK09302509 circadian clock protein KaiC; Reviewed 88.88
TIGR00376 637 DNA helicase, putative. The gene product may repre 88.76
COG1100219 GTPase SAR1 and related small G proteins [General 88.7
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 88.67
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 88.66
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 88.53
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 88.33
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 88.31
PHA02530300 pseT polynucleotide kinase; Provisional 88.3
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 88.2
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 88.16
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 88.16
PF00004132 AAA: ATPase family associated with various cellula 88.13
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 88.11
PRK09519 790 recA DNA recombination protein RecA; Reviewed 88.1
PRK12338319 hypothetical protein; Provisional 88.03
PRK03003472 GTP-binding protein Der; Reviewed 88.01
PRK13949169 shikimate kinase; Provisional 87.89
PRK06851367 hypothetical protein; Provisional 87.87
PLN02165334 adenylate isopentenyltransferase 87.86
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 87.69
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 87.53
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=8.3e-41  Score=321.28  Aligned_cols=287  Identities=39%  Similarity=0.640  Sum_probs=220.0

Q ss_pred             hhhHHHHHHhcCCCccceeEEeeecCCCCcccccccccccCCCeEEEEEcCCCCChHHHHHHHHHHHHHHCCCcEEEEEe
Q 015919            2 FEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDA   81 (398)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kvI~v~s~KGGvGKTT~a~nLA~~La~~G~rVllIDl   81 (398)
                      |.+.|.++|.+++|++.+.++++..... .....-...+.+|+++|+|.|+||||||||+|+|||.+||+.|+||++||+
T Consensus        66 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~vIaV~S~KGGVGKTT~avNLA~aLA~~G~rVlLID~  144 (369)
T PRK11670         66 LKEQCSAELLRITGAKAIDWKLSHNIAT-LKRVNNQPGVNGVKNIIAVSSGKGGVGKSSTAVNLALALAAEGAKVGILDA  144 (369)
T ss_pred             HHHHHHHHHHhcCCCceEEEEEeeehhh-hccccccccCCCCCEEEEEeCCCCCCCHHHHHHHHHHHHHHCCCcEEEEeC
Confidence            5678999999999999999988875321 101011235777899999999999999999999999999999999999999


Q ss_pred             cCCCCCCCcccCCcccccccCCCCCceeeeccCCeEEEeccc--CCCcccccCCccHHHHHHHHHhhccCCCCcEEEEcC
Q 015919           82 DVYGPSLPTMVSPENRLLEMNPEKRTIIPTEYLGVKLVSFGF--SGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDM  159 (398)
Q Consensus        82 D~q~~~~~~~l~~~~~~~~~~~~~~~i~~~~~~~l~vlp~~~--~~~~~~~~~~~~~~~~l~~ll~~~~~~~yD~VIID~  159 (398)
                      |+|+++++.++|.+...... .....+.+....++...+.+.  .......++++.....+.+++....|+.||||||||
T Consensus       145 D~qgps~~~~lg~~~~~~~~-~~~~~i~p~~~~g~~~~~~~~l~~~~~~~i~~g~~~~~~l~~~l~~~~~~~yDyvIID~  223 (369)
T PRK11670        145 DIYGPSIPTMLGAEDQRPTS-PDGTHMAPIMAHGLATNSIGYLVTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVLDM  223 (369)
T ss_pred             CCCCCCcchhcCCcccCCcc-cCCceeeeeeccCcccccHHHhcCcCcceeecCcchHHHHHHHHHHHhhccCCEEEEeC
Confidence            99999998888764321111 011122332223333222111  111223345555566777777543368999999999


Q ss_pred             CCCCChhhhhhhhhcCCCeEEEEeCCChhhHHHHHHHHHHHhccCCCeeEEEEccccccCC--CceecccCCChHHHHHH
Q 015919          160 PPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDAD--GKRYYPFGRGSGSQVVQ  237 (398)
Q Consensus       160 pp~~~~~~~~~~~~~a~d~viiv~~p~~~s~~~~~~~~~~l~~~~~~~~~vV~N~~~~~~~--~~~~~~~~~~~~~~~~~  237 (398)
                      ||++++..+...++.++|.+++|++|+..++.++.+.++.+.+.+++++|+|+||+.+.+.  .+....+.++..+.+++
T Consensus       224 PPg~gd~~l~~~~l~aad~viiV~tp~~~s~~da~~~i~~~~~~~~~ilGiV~Nm~~~~~~~~~~~~~if~~~~~~~lae  303 (369)
T PRK11670        224 PPGTGDIQLTLAQNIPVTGAVVVTTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSMHICSNCGHHEPIFGTGGAEKLAE  303 (369)
T ss_pred             CCCCchHHHHHhhhccCCeEEEEecCchhHHHHHHHHHHHHhccCCCeEEEEEcCCccccCCccchhhhcccchHHHHHH
Confidence            9999987666656778899999999999999999999999999999999999999866543  22222345567899999


Q ss_pred             HhCCCeEEecCCChhhhhcccCCCceEeeCCCCHHHHHHHHHHHHHHHHHHHh
Q 015919          238 QFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGVCVVQQCAKI  290 (398)
Q Consensus       238 ~~g~~~~~~ip~~~~i~~a~~~g~~v~~~~~~s~~~~~~~~la~~i~~~i~~~  290 (398)
                      .++.++++.||.+..+.++...|+|+..+.|+++.+++|.+|++++.+++...
T Consensus       304 ~~~~~ll~~IP~~~~I~ea~~~G~Pv~~~~p~s~~a~~y~~LA~el~~~~~~~  356 (369)
T PRK11670        304 KYHTQLLGQMPLHISLREDLDRGTPTVVSRPESEFTAIYRQLADRVAAQLYWQ  356 (369)
T ss_pred             HcCCcEEEEeCCChHHHHHHHCCCcEEEeCCCCHHHHHHHHHHHHHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999988544



>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PF06155 DUF971: Protein of unknown function (DUF971); InterPro: IPR010376 This domain is found in gamma-butyrobetaine dioxygenase and trimethyllysine dioxygenase proteins Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family Back     alignment and domain information
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments Back     alignment and domain information
>COG3536 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02409 carnitine_bodg gamma-butyrobetaine hydroxylase Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>TIGR02410 carnitine_TMLD trimethyllysine dioxygenase Back     alignment and domain information
>KOG3888 consensus Gamma-butyrobetaine,2-oxoglutarate dioxygenase [Lipid transport and metabolism] Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3889 consensus Predicted gamma-butyrobetaine,2-oxoglutarate dioxygenase [Lipid transport and metabolism] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00347 bioD dethiobiotin synthase Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00345 arsA arsenite-activated ATPase (arsA) Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK12374 putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] Back     alignment and domain information
>PRK05632 phosphate acetyltransferase; Reviewed Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK13505 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PF06155 DUF971: Protein of unknown function (DUF971); InterPro: IPR010376 This domain is found in gamma-butyrobetaine dioxygenase and trimethyllysine dioxygenase proteins Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>COG0857 Pta BioD-like N-terminal domain of phosphotransacetylase [General function prediction only] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK13506 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PF07755 DUF1611: Protein of unknown function (DUF1611); InterPro: IPR011669 This entry contains a number of hypothetical bacterial and archaeal proteins Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00682 lpxK tetraacyldisaccharide 4'-kinase Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK01906 tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>COG3367 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] Back     alignment and domain information
>COG2403 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>KOG3888 consensus Gamma-butyrobetaine,2-oxoglutarate dioxygenase [Lipid transport and metabolism] Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK06749 replicative DNA helicase; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF06418 CTP_synth_N: CTP synthase N-terminus; InterPro: IPR017456 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism, catalysing the synthesis of CTP from UTP by amination of the pyrimidine ring at the 4-position [] Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query398
3kb1_A262 Crystal Structure Of The Nucleotide-Binding Protein 2e-39
2ph1_A262 Crystal Structure Of Nucleotide-Binding Protein Af2 1e-37
3vx3_A248 Crystal Structure Of [nife] Hydrogenase Maturation 1e-28
1hyq_A263 Mind Bacterial Cell Division Regulator From A. Fulg 1e-05
>pdb|3KB1|A Chain A, Crystal Structure Of The Nucleotide-Binding Protein Af_226 In Complex With Adp From Archaeoglobus Fulgidus, Northeast Structural Genomics Consortium Target Gr157 Length = 262 Back     alignment and structure

Iteration: 1

Score = 159 bits (403), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 94/235 (40%), Positives = 130/235 (55%), Gaps = 5/235 (2%) Query: 34 EQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVS 93 E + E L KI +AV S KGGVGKSTV LA A G +VGI DAD GPS+P + Sbjct: 8 EDIKERLDKIGFRIAVXSGKGGVGKSTVTALLAVHYAKQGKKVGILDADFLGPSIPHLFG 67 Query: 94 PENRLLEMNPEKRTIIPTEYLGVKLVSFGFSGQGR---AIMRGPMVSGVINQLLTTTEWG 150 E + ++ E + T+ LG+K+ S F R I RGP+++G I + L WG Sbjct: 68 LEKGKVAVSDEGLEPVLTQRLGIKVXSIQFLLPKRETPVIWRGPLIAGXIREFLGRVAWG 127 Query: 151 ELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAV 210 ELDYL+ID+PPGTGD LT+ Q AVIV+TPQ+L V K + + K + + Sbjct: 128 ELDYLLIDLPPGTGDAPLTVXQDAKPNGAVIVSTPQELTAAVVEKAITXAEQTKTAVLGI 187 Query: 211 VENMCHFDAD--GKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPE 263 VEN +F+ G+R Y FG G S++ +++ I + ++PI L D G E Sbjct: 188 VENXAYFECPNCGERTYLFGEGKASELARKYKIEFITEIPIDSDLLKLSDLGRVE 242
>pdb|2PH1|A Chain A, Crystal Structure Of Nucleotide-Binding Protein Af2382 From Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr165 Length = 262 Back     alignment and structure
>pdb|3VX3|A Chain A, Crystal Structure Of [nife] Hydrogenase Maturation Protein Hypb From Thermococcus Kodakarensis Kod1 Length = 248 Back     alignment and structure
>pdb|1HYQ|A Chain A, Mind Bacterial Cell Division Regulator From A. Fulgidus Length = 263 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query398
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 1e-105
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 5e-22
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 9e-22
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 2e-19
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 5e-19
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 6e-15
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 2e-13
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 2e-12
3luu_A101 Uncharacterized protein; AFE_2189, PFAM DUF971 fam 3e-12
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 4e-12
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 1e-11
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 5e-11
2l6n_A132 Uncharacterized protein YP_001092504.1; PJ06155C, 1e-10
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 3e-10
3cwq_A209 Para family chromosome partitioning protein; alpha 4e-10
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 3e-09
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 2e-08
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 4e-08
2l6p_A124 PHAC1, PHAC2 and PHAD genes; DUF971, structural ge 8e-08
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 1e-07
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 1e-07
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 6e-07
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 2e-06
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 9e-06
3igf_A374 ALL4481 protein; two-domained protein consisting o 2e-05
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 4e-05
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 5e-05
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 1e-04
3end_A307 Light-independent protochlorophyllide reductase ir 2e-04
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 3e-04
3o2g_A 388 Gamma-butyrobetaine dioxygenase; gamma-butyrobetai 3e-04
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Length = 262 Back     alignment and structure
 Score =  309 bits (794), Expect = e-105
 Identities = 93/245 (37%), Positives = 133/245 (54%), Gaps = 5/245 (2%)

Query: 34  EQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVS 93
           E++ E L KI + +AV S KGGVGKSTV   LA   A  G +VGI DAD  GPS+P +  
Sbjct: 8   EEIKERLGKIKSRIAVMSGKGGVGKSTVTALLAVHYARQGKKVGILDADFLGPSIPILFG 67

Query: 94  PENRLLEMNPEKRTIIPTEYLGVKLVSFGF--SGQGRA-IMRGPMVSGVINQLLTTTEWG 150
             N  + ++ E    + T+  G+K++S  F    +    I RGP+++G+I + L    WG
Sbjct: 68  LRNARIAVSAEGLEPVLTQKYGIKVMSMQFLLPKENTPVIWRGPLIAGMIREFLGRVAWG 127

Query: 151 ELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAV 210
           ELD+L+ID+PPGTGD  LT+ Q    T  V+V+TPQ+L  + V K + M  +     + +
Sbjct: 128 ELDHLLIDLPPGTGDAPLTVMQDAKPTGVVVVSTPQELTAVIVEKAINMAEETNTSVLGL 187

Query: 211 VENMCHF--DADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADP 268
           VENM +F     G + Y FG G G  + +++ I     +PI   L    DSG  E     
Sbjct: 188 VENMSYFVCPNCGHKSYIFGEGKGESLAKKYNIGFFTSIPIEEELIKLADSGRIEEYEKD 247

Query: 269 CGEVA 273
             E A
Sbjct: 248 WFESA 252


>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Length = 254 Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Length = 373 Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Length = 263 Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Length = 245 Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Length = 237 Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Length = 260 Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Length = 299 Back     alignment and structure
>3luu_A Uncharacterized protein; AFE_2189, PFAM DUF971 family, structural genomics, joint CEN structural genomics, JCSG; HET: MSE; 1.93A {Acidithiobacillus ferrooxidans} Length = 101 Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Length = 286 Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Length = 271 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Length = 206 Back     alignment and structure
>2l6n_A Uncharacterized protein YP_001092504.1; PJ06155C, DUF971, structural genomics, PSI-biology, protein initiative; NMR {Shewanella loihica} Length = 132 Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Length = 286 Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Length = 209 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Length = 398 Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Length = 298 Back     alignment and structure
>2l6p_A PHAC1, PHAC2 and PHAD genes; DUF971, structural genomics, PSI-biology, protein structure initiative, joint center for structural genomics; NMR {Pseudomonas aeruginosa} Length = 124 Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Length = 257 Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Length = 267 Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Length = 361 Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Length = 329 Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Length = 403 Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Length = 374 Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 324 Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Length = 334 Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Length = 349 Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Length = 289 Back     alignment and structure
>3o2g_A Gamma-butyrobetaine dioxygenase; gamma-butyrobetaine hydroxylase, 2-OXOG dioxygenase 1, oxidoreductase, structural genomics; HET: OGA NM2; 1.78A {Homo sapiens} PDB: 3ms5_A* 3n6w_A Length = 388 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query398
3fwy_A314 Light-independent protochlorophyllide reductase I 100.0
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 100.0
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 100.0
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 100.0
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 100.0
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 100.0
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 100.0
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 100.0
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 100.0
3end_A307 Light-independent protochlorophyllide reductase ir 100.0
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 100.0
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 99.98
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 99.98
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 99.97
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 99.97
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 99.97
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 99.97
3cwq_A209 Para family chromosome partitioning protein; alpha 99.97
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 99.96
3luu_A101 Uncharacterized protein; AFE_2189, PFAM DUF971 fam 99.96
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 99.93
2l6n_A132 Uncharacterized protein YP_001092504.1; PJ06155C, 99.93
2l6p_A124 PHAC1, PHAC2 and PHAD genes; DUF971, structural ge 99.93
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 99.92
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 99.92
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 99.91
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 99.89
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 99.89
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 99.89
3o2g_A 388 Gamma-butyrobetaine dioxygenase; gamma-butyrobetai 99.87
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 99.86
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 99.86
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 99.86
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 99.85
3igf_A374 ALL4481 protein; two-domained protein consisting o 99.8
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 99.76
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 99.75
2xxa_A433 Signal recognition particle protein; protein trans 99.66
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 99.59
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 99.54
3of5_A228 Dethiobiotin synthetase; structural genomics, cent 99.53
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 99.53
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 99.48
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.47
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD 99.39
3qxc_A242 Dethiobiotin synthetase; DTBS, structural genomics 99.38
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 99.37
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 99.35
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 99.33
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 99.22
1vma_A306 Cell division protein FTSY; TM0570, structural gen 99.21
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 99.09
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.96
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 98.94
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.51
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.18
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.16
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.13
2obn_A349 Hypothetical protein; structural genomics, joint c 98.01
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 97.8
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.76
3pzx_A 557 Formate--tetrahydrofolate ligase; HET: TOE; 2.20A 97.69
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.67
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 97.55
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 97.53
3luu_A101 Uncharacterized protein; AFE_2189, PFAM DUF971 fam 97.44
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.31
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 97.11
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.03
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 96.99
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 96.91
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 96.84
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 96.77
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.75
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 96.74
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 96.71
2elf_A370 Protein translation elongation factor 1A; tRNA, py 96.68
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.66
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.66
3t1o_A198 Gliding protein MGLA; G domain containing protein, 96.65
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 96.64
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.58
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 96.53
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 96.53
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 96.52
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 96.52
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 96.5
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 96.47
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 96.45
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 96.43
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 96.37
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.34
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 96.34
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 96.33
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 96.32
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 96.3
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 96.29
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 96.28
2g0t_A350 Conserved hypothetical protein; structural genomic 96.25
3iby_A256 Ferrous iron transport protein B; G protein, G dom 96.24
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 96.23
2l6n_A132 Uncharacterized protein YP_001092504.1; PJ06155C, 96.21
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 96.21
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.21
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.17
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 96.17
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 96.16
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.14
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 96.12
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 96.12
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 96.12
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 96.09
2hf9_A226 Probable hydrogenase nickel incorporation protein 96.09
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 96.07
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 96.06
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.01
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 95.98
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.96
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 95.95
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 95.94
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.91
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.88
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.87
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 95.86
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 95.84
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.82
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 95.82
2og2_A359 Putative signal recognition particle receptor; nuc 95.8
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 95.66
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.65
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 95.65
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.64
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 95.62
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.62
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 95.61
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.59
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 95.58
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.54
3lxx_A239 GTPase IMAP family member 4; structural genomics c 95.53
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 95.5
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 95.47
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 95.45
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.44
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 95.41
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 95.4
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.39
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.37
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 95.32
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.32
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 95.32
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 95.32
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 95.3
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 95.3
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 95.29
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 95.29
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 95.29
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.25
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.24
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 95.24
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 95.23
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 95.19
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 95.14
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 95.1
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.07
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 95.06
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 95.06
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 95.03
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 95.01
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 94.96
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.95
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 94.94
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 94.93
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 94.93
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.92
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.9
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.9
3o47_A329 ADP-ribosylation factor GTPase-activating protein 94.9
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.85
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 94.84
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 94.82
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 94.8
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 94.78
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 94.72
1vco_A 550 CTP synthetase; tetramer, riken structural genomic 94.71
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 94.71
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 94.7
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 94.7
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 94.68
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 94.63
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 94.62
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 94.6
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 94.59
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 94.57
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.52
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 94.49
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 94.49
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 94.46
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 94.41
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 94.41
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 94.4
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 94.34
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 94.28
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 94.27
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 94.23
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 94.18
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 94.18
3lxw_A247 GTPase IMAP family member 1; immunity, structural 94.17
2ged_A193 SR-beta, signal recognition particle receptor beta 94.13
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 94.09
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 94.02
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 94.0
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 93.97
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.92
2l6p_A124 PHAC1, PHAC2 and PHAD genes; DUF971, structural ge 93.91
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 93.91
1s1m_A 545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 93.89
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 93.87
3llu_A196 RAS-related GTP-binding protein C; structural geno 93.78
3bos_A242 Putative DNA replication factor; P-loop containing 93.77
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 93.76
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 93.73
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 93.71
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.7
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 93.64
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 93.59
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 93.53
2kjq_A149 DNAA-related protein; solution structure, NESG, st 93.52
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 93.47
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.46
1via_A175 Shikimate kinase; structural genomics, transferase 93.45
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 93.44
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 93.44
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.32
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 93.31
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.28
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 93.13
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.04
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 93.01
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 92.97
1nrj_B218 SR-beta, signal recognition particle receptor beta 92.92
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 92.86
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 92.84
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 92.82
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.8
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 92.71
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 92.66
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 92.66
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.64
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 92.61
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 92.6
2qgz_A308 Helicase loader, putative primosome component; str 92.57
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 92.5
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.48
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 92.47
1wb1_A 482 Translation elongation factor SELB; selenocysteine 92.47
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 92.4
2z43_A324 DNA repair and recombination protein RADA; archaea 92.38
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 92.38
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 92.37
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 92.37
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 92.36
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 92.31
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 92.28
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 92.27
1kag_A173 SKI, shikimate kinase I; transferase, structural g 92.2
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 92.06
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 92.03
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.02
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 91.97
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 91.8
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 91.8
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 91.78
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 91.71
3vaa_A199 Shikimate kinase, SK; structural genomics, center 91.67
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.66
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 91.63
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 91.61
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 91.61
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 91.6
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 91.58
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 91.56
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 91.55
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 91.55
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.28
2c5m_A294 CTP synthase; cytidine 5-prime triphosphate synthe 91.19
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 91.01
3io5_A333 Recombination and repair protein; storage dimer, i 91.0
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 91.0
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 90.9
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 90.8
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 90.77
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 90.75
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 90.74
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 90.7
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 90.65
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 90.57
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 90.43
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 90.39
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 90.35
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 90.31
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 90.3
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 90.22
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 90.21
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 90.14
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 90.14
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 90.05
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 90.02
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 89.6
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 89.57
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 89.5
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 89.45
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 89.33
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 89.31
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 89.31
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 89.21
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 89.12
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 89.01
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 88.98
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 88.97
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 88.93
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 88.8
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 88.79
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 88.75
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 88.64
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 88.61
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 88.53
2chg_A226 Replication factor C small subunit; DNA-binding pr 88.49
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 88.44
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 88.43
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 88.43
4ehx_A315 Tetraacyldisaccharide 4'-kinase; membrane protein, 88.41
3nva_A 535 CTP synthase; rossman fold, nucleotide binding, LI 88.28
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 88.27
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 88.16
1w78_A422 FOLC bifunctional protein; DHFS, dihydrofolate syn 88.15
2vo1_A295 CTP synthase 1; pyrimidine biosynthesis, glutamine 88.11
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 88.08
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 87.91
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 87.91
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 87.89
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 87.87
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 87.72
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 87.56
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 87.43
1jbw_A428 Folylpolyglutamate synthase; FPGS folate AMPPCP te 87.39
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 87.33
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 87.04
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 87.03
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 86.92
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 86.83
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 86.74
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 86.74
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 86.64
4a74_A231 DNA repair and recombination protein RADA; hydrola 86.61
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 86.58
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 86.57
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 86.47
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 86.46
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 86.46
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 86.4
3nrs_A437 Dihydrofolate:folylpolyglutamate synthetase; struc 86.32
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 86.24
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 86.19
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 86.18
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 86.11
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 86.07
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 85.97
2vli_A183 Antibiotic resistance protein; transferase, tunica 85.84
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 85.83
1e8c_A498 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diami 85.78
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 85.77
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 85.6
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 85.44
3do6_A 543 Formate--tetrahydrofolate ligase; TM1766, putative 85.3
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 85.27
2v1u_A387 Cell division control protein 6 homolog; DNA repli 85.21
2wtz_A535 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-di 85.0
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 84.74
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 84.74
1o5z_A442 Folylpolyglutamate synthase/dihydrofolate synthas; 84.66
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 84.66
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 84.64
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 84.42
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 84.39
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 84.39
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 84.35
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 84.28
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 84.14
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 84.11
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 84.09
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 84.07
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 84.07
2vos_A487 Folylpolyglutamate synthase protein FOLC; ligase, 83.9
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 83.64
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 83.58
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 83.53
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 83.25
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 83.25
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 83.2
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 83.06
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 82.85
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 82.7
3r20_A233 Cytidylate kinase; structural genomics, seattle st 82.69
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 82.53
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 82.49
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 82.28
3gem_A260 Short chain dehydrogenase; structural genomics, AP 81.89
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 81.74
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 81.61
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 81.55
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 81.53
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 81.47
3tlx_A243 Adenylate kinase 2; structural genomics, structura 81.1
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 81.07
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 81.02
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 80.85
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 80.64
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 80.6
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 80.48
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 80.45
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 80.24
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 80.23
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 80.11
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
Probab=100.00  E-value=1.9e-34  Score=271.61  Aligned_cols=232  Identities=18%  Similarity=0.151  Sum_probs=174.6

Q ss_pred             CCCeEEEEEcCCCCChHHHHHHHHHHHHHHCCCcEEEEEecCCCCCCCcccCCcc-ccc---------ccCCCCCceeee
Q 015919           42 KISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPEN-RLL---------EMNPEKRTIIPT  111 (398)
Q Consensus        42 ~~~kvI~v~s~KGGvGKTT~a~nLA~~La~~G~rVllIDlD~q~~~~~~~l~~~~-~~~---------~~~~~~~~i~~~  111 (398)
                      ..+|||||+ +||||||||+|+|||.+||++|+||++||+|||++++..+++... ...         ......+.....
T Consensus        46 ~~aKVIAIa-GKGGVGKTTtavNLA~aLA~~GkkVllID~Dpq~~s~~~l~~~~~~~~~~~~~~~~~~~~~~~~~d~i~~  124 (314)
T 3fwy_A           46 TGAKVFAVY-GKGGIGKSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTGSLVPTVIDVLKDVDFHPEELRPEDFVFE  124 (314)
T ss_dssp             -CCEEEEEE-CSTTSSHHHHHHHHHHHHHHTTCCEEEEEESSSCCTTHHHHTSCCCCHHHHHHHTTSCGGGCCHHHHCEE
T ss_pred             CCceEEEEE-CCCccCHHHHHHHHHHHHHHCCCeEEEEecCCCCcccccccCCCCCcchhhHhhhccccccccHhHheee
Confidence            357999998 699999999999999999999999999999999988766543221 110         011111223445


Q ss_pred             ccCCeEEEecccCCCcccccCCccHHHHHHHHHhhccCCCCcEEEEcCCCCCChhhhhhhhhcCCCeEEEEeCCChhhHH
Q 015919          112 EYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFI  191 (398)
Q Consensus       112 ~~~~l~vlp~~~~~~~~~~~~~~~~~~~l~~ll~~~~~~~yD~VIID~pp~~~~~~~~~~~~~a~d~viiv~~p~~~s~~  191 (398)
                      ...++.++|++....... .........+..+.....++.|||+++||+++....... +.+.++|.+++|++|+..|+.
T Consensus       125 ~~~~i~~v~~~~~~~~~~-~~~~~~~~~~~~l~~~~~~d~~D~v~iD~~~~~~~~~~~-~al~aAd~viIvt~~e~~Al~  202 (314)
T 3fwy_A          125 GFNGVMCVEAGGPPAGTG-CGGYVVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGFA-APLQHADQAVVVTANDFDSIY  202 (314)
T ss_dssp             CGGGCEEEECCCCCTTCS-CTTHHHHHHHHHHHHTTTTSSCSEEEEEECCSSCCGGGG-GGGGTCSEEEEEECSSHHHHH
T ss_pred             cCCCeEEEeCCCCcccch-hhhccHHHHHHHHHhcchhhcCceEeeccCCcchhhhhH-hHHhhCCeEEEEeCCcHHHHH
Confidence            567899999765433221 122223334444444333589999999999988766552 336688999999999999999


Q ss_pred             HHHHHHHHHhcc----CCCeeEEEEccccccCCCceecccCCChHHHHHHHhCCCeEEecCCChhhhhcccCCCceEeeC
Q 015919          192 DVAKGVRMFSKL----KVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAAD  267 (398)
Q Consensus       192 ~~~~~~~~l~~~----~~~~~~vV~N~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~ip~~~~i~~a~~~g~~v~~~~  267 (398)
                      ++.++++.++.+    +.+..|+|+|+...           ....+++.++++.++++.||.+..+++|...|+|+++++
T Consensus       203 ~~~~l~~~i~~~~~~~~~~l~GiI~n~~~~-----------~~~v~~~a~~~~~~~lg~IP~d~~Vr~a~~~G~pvv~~~  271 (314)
T 3fwy_A          203 AMNRIIAAVQAKSKNYKVRLAGCVANRSRA-----------TDEVDRFCKETNFRRLAHMPDLDAIRRSRLKKKTLFEMD  271 (314)
T ss_dssp             HHHHHHHHHHTTTTTCCCEEEEEEEESCSC-----------CHHHHHHHHHHTCCEEEEECCCHHHHHHHHTTCCTTTSC
T ss_pred             HHHHHHHHHHHHhccCCCceEEEEEcCCCc-----------hhHHHHHHHHhCCeEEEEecCchHHHHHHHcCCceEEEC
Confidence            999988887754    45567899997422           135688999999999999999999999999999999999


Q ss_pred             CCCHHHHH---HHHHHHHHHHHH
Q 015919          268 PCGEVANT---FQDLGVCVVQQC  287 (398)
Q Consensus       268 ~~s~~~~~---~~~la~~i~~~i  287 (398)
                      |+|+.+++   |++||++|+++.
T Consensus       272 P~S~~a~aa~~Y~~LA~eil~~~  294 (314)
T 3fwy_A          272 EDQDVLAARAEYIRLAESLWRGL  294 (314)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHCC
T ss_pred             CCChhhHHHHHHHHHHHHHHhCC
Confidence            99986655   999999998654



>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3luu_A Uncharacterized protein; AFE_2189, PFAM DUF971 family, structural genomics, joint CEN structural genomics, JCSG; HET: MSE; 1.93A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>2l6n_A Uncharacterized protein YP_001092504.1; PJ06155C, DUF971, structural genomics, PSI-biology, protein initiative; NMR {Shewanella loihica} Back     alignment and structure
>2l6p_A PHAC1, PHAC2 and PHAD genes; DUF971, structural genomics, PSI-biology, protein structure initiative, joint center for structural genomics; NMR {Pseudomonas aeruginosa} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>3o2g_A Gamma-butyrobetaine dioxygenase; gamma-butyrobetaine hydroxylase, 2-OXOG dioxygenase 1, oxidoreductase, structural genomics; HET: OGA NM2; 1.78A {Homo sapiens} PDB: 3ms5_A* 3n6w_A Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* Back     alignment and structure
>3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3luu_A Uncharacterized protein; AFE_2189, PFAM DUF971 family, structural genomics, joint CEN structural genomics, JCSG; HET: MSE; 1.93A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2l6n_A Uncharacterized protein YP_001092504.1; PJ06155C, DUF971, structural genomics, PSI-biology, protein initiative; NMR {Shewanella loihica} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2l6p_A PHAC1, PHAC2 and PHAD genes; DUF971, structural genomics, PSI-biology, protein structure initiative, joint center for structural genomics; NMR {Pseudomonas aeruginosa} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>4ehx_A Tetraacyldisaccharide 4'-kinase; membrane protein, lipid A, P-loop, P-loop containing nucleoside triphosphate hydrolase; HET: EPE; 1.90A {Aquifex aeolicus} PDB: 4ehy_A* 4ehw_A Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* Back     alignment and structure
>2vo1_A CTP synthase 1; pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphos synthetase, UTP; 2.8A {Homo sapiens} SCOP: c.37.1.10 PDB: 3ihl_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* 3pyz_A* 3qcz_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.00A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3do6_A Formate--tetrahydrofolate ligase; TM1766, putative formyltetrahydrofolate synthetase, structural genomics; HET: MSE; 1.85A {Thermotoga maritima} SCOP: c.37.1.0 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, C shape; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} PDB: 2xja_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1o5z_A Folylpolyglutamate synthase/dihydrofolate synthas; TM0166, structural genomics, JC protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2vos_A Folylpolyglutamate synthase protein FOLC; ligase, peptidoglycan synthesis, cell division; HET: ADP; 2.0A {Mycobacterium tuberculosis} PDB: 2vor_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 398
d1ihua2279 c.37.1.10 (A:308-586) Arsenite-translocating ATPas 1e-31
d1cp2a_269 c.37.1.10 (A:) Nitrogenase iron protein {Clostridi 2e-28
d2afhe1289 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azot 4e-27
d1g3qa_237 c.37.1.10 (A:) Cell division regulator MinD {Archa 2e-24
d1ihua1296 c.37.1.10 (A:1-296) Arsenite-translocating ATPase 8e-23
d1hyqa_232 c.37.1.10 (A:) Cell division regulator MinD {Archa 4e-22
d1byia_224 c.37.1.10 (A:) Dethiobiotin synthetase {Escherichi 4e-20
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 0.002
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 279 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Arsenite-translocating ATPase ArsA
species: Escherichia coli [TaxId: 562]
 Score =  119 bits (298), Expect = 1e-31
 Identities = 44/263 (16%), Positives = 78/263 (29%), Gaps = 37/263 (14%)

Query: 26  QPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYG 85
           +P  P     L + + +  + + +   KGGVGK+T+A  +A  LA MG  V +  +D   
Sbjct: 2   RPDIPSL-SALVDDIARNEHGLIMLMGKGGVGKTTMAAAIAVRLADMGFDVHLTTSDPAA 60

Query: 86  PSLPTMVSPENRLL------EMNPEKRTIIPTEYLGVKLVSFGFSGQGR-AIMRGPMVSG 138
               T+    N L           E+      E  G +L   G                 
Sbjct: 61  HLSMTLNGSLNNLQVSRIDPHEETERYRQHVLETKGKELDEAGKRLLEEDLRSPCTEEIA 120

Query: 139 VINQLLTTTEWGELDYLVIDMPP-------------------------GTGDIQLTLCQV 173
           V              ++V+D  P                         G     + L Q 
Sbjct: 121 VFQAFSRVIREAGKRFVVMDTAPTGHTLLLLDATGAYHREIAKKMGEKGHFTTPMMLLQD 180

Query: 174 VPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGS 233
              T  ++VT P+    ++ A       +  +     + N     AD +      R    
Sbjct: 181 PERTKVLLVTLPETTPVLEAANLQADLERAGIHPWGWIINNSLSIADTRSPLLRMRAQQE 240

Query: 234 Q----VVQQFGIPHLFDLPIRPT 252
                 V++     +  +P+  +
Sbjct: 241 LPQIESVKRQHASRVALVPVLAS 263


>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Length = 269 Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Length = 289 Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 237 Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 232 Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Length = 224 Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query398
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 100.0
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 100.0
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 100.0
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 100.0
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 99.88
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 99.85
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 99.81
d1ls1a2207 GTPase domain of the signal sequence recognition p 99.0
d2qy9a2211 GTPase domain of the signal recognition particle r 98.88
d1okkd2207 GTPase domain of the signal recognition particle r 98.84
d1vmaa2213 GTPase domain of the signal recognition particle r 98.79
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.63
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 98.25
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.21
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.99
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 97.87
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.73
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.64
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.47
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 97.23
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.04
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 96.82
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.79
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.63
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.15
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.13
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.13
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.08
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 95.9
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 95.89
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.78
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.71
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 95.69
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.55
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.51
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.51
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.43
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 95.4
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.37
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 95.37
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 95.33
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.33
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.3
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.25
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.24
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.23
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 95.21
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 95.17
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 95.11
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 95.07
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.96
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.83
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 94.76
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.63
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.59
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 94.55
d1e8ca3234 UDP-N-acetylmuramyl tripeptide synthetase MurE {Es 94.53
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 94.47
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.42
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 94.38
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.32
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 94.27
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.22
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.2
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 94.13
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.06
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.83
d2g0ta1338 Hypothetical protein TM0796 {Thermotoga maritima [ 93.69
d1s1ma2266 CTP synthase PyrG, N-terminal domain {Escherichia 93.63
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.46
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 93.26
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 93.17
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.15
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.11
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.93
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.86
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.81
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.75
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.6
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.58
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.54
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.41
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.28
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.19
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 92.08
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 92.08
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.08
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 91.78
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 91.72
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.66
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.56
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.52
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.24
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.13
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.05
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 90.97
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.9
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.59
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 90.59
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.49
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 90.36
d1p3da3215 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 90.21
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 90.07
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 89.74
d2jfga3204 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 89.69
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 89.53
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.43
d1gg4a4214 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 89.37
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.36
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 89.35
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 89.22
d2gc6a2296 Folylpolyglutamate synthetase {Lactobacillus casei 89.21
d1j6ua3207 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 88.77
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.66
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 88.28
d2vo1a1273 CTP synthase PyrG, N-terminal domain {Human (Homo 88.05
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 87.9
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 87.81
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 87.65
d1eg7a_ 549 Formyltetrahydrofolate synthetase {Moorella thermo 87.42
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 87.02
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 86.93
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 86.9
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 86.65
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 86.56
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 86.29
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 86.25
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 86.2
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 86.06
d1vcoa2272 CTP synthase PyrG, N-terminal domain {Thermus ther 85.88
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 85.7
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 85.55
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 85.54
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 85.5
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 84.9
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 84.78
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 84.74
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 84.46
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 84.35
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 84.06
d2auwa284 Hypothetical protein NE0471 N-terminal domain {Nit 84.04
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 83.92
d1o5za2296 Folylpolyglutamate synthetase {Thermotoga maritima 83.78
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 83.14
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 82.33
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 81.83
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 81.8
d2cu6a191 Hypothetical protein TTHB138 {Thermus thermophilus 81.55
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 81.46
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.44
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 81.41
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 81.34
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 81.32
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 81.19
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 81.04
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 80.58
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 80.41
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 80.32
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Cell division regulator MinD
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=100.00  E-value=2.1e-37  Score=278.49  Aligned_cols=225  Identities=23%  Similarity=0.283  Sum_probs=183.1

Q ss_pred             CeEEEEEcCCCCChHHHHHHHHHHHHHHCCCcEEEEEecCCCCCCCcccCCccc------ccccCCCCCceeeeccCCeE
Q 015919           44 SNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENR------LLEMNPEKRTIIPTEYLGVK  117 (398)
Q Consensus        44 ~kvI~v~s~KGGvGKTT~a~nLA~~La~~G~rVllIDlD~q~~~~~~~l~~~~~------~~~~~~~~~~i~~~~~~~l~  117 (398)
                      ||+|+|+|+||||||||+|+|||.+||++|+||++||+|++++++..+++.+..      ........+........+++
T Consensus         1 ~kvIav~s~KGGvGKTtia~nlA~~la~~g~~VlliD~D~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (232)
T d1hyqa_           1 VRTITVASGKGGTGKTTITANLGVALAQLGHDVTIVDADITMANLELILGMEGLPVTLQNVLAGEARIDEAIYVGPGGVK   80 (232)
T ss_dssp             CEEEEEEESSSCSCHHHHHHHHHHHHHHTTCCEEEEECCCSSSSHHHHTTCCCCCCCHHHHHTTSSCGGGGCEECGGGCE
T ss_pred             CEEEEEECCCCCChHHHHHHHHHHHHHhCCCCEEEEeCCCCCCCHHHHhCCCcCcchhhhhhccccccccccccCCccce
Confidence            799999999999999999999999999999999999999999998888876542      22222333344455668999


Q ss_pred             EEecccCCCcccccCCccHHHHHHHHHhhccCCCCcEEEEcCCCCCChhhhhhhhhcCCCeEEEEeCCChhhHHHHHHHH
Q 015919          118 LVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGV  197 (398)
Q Consensus       118 vlp~~~~~~~~~~~~~~~~~~~l~~ll~~~~~~~yD~VIID~pp~~~~~~~~~~~~~a~d~viiv~~p~~~s~~~~~~~~  197 (398)
                      ++|++...........    ..++.+++.+ +..||+||||+||+++..+...  +..+|.+++|+.|+..++..+.+.+
T Consensus        81 ~l~~~~~~~~~~~~~~----~~l~~~l~~l-~~~~D~viiD~~~~~~~~~~~~--l~~ad~v~~v~~~~~~~~~~~~~~~  153 (232)
T d1hyqa_          81 VVPAGVSLEGLRKANP----EKLEDVLTQI-MESTDILLLDAPAGLERSAVIA--IAAAQELLLVVNPEISSITDGLKTK  153 (232)
T ss_dssp             EEECCSCHHHHHHHCH----HHHHHHHHHH-HHTCSEEEEECCSSSSHHHHHH--HHHSSEEEEEECSSHHHHHHHHHHH
T ss_pred             eEeeecccccccccch----hhHHHHHHHH-hhccceeeecccccccchhHHH--hhhhheeeeeccccccchhhhhhhh
Confidence            9997755433322222    3345555554 3799999999999999877665  4578999999999999999999999


Q ss_pred             HHHhccCCCeeEEEEccccccCCCceecccCCChHHHHHHHhCCCeEEecCCChhhhhcccCCCceEeeCCCCHHHHHHH
Q 015919          198 RMFSKLKVPCIAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQ  277 (398)
Q Consensus       198 ~~l~~~~~~~~~vV~N~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~ip~~~~i~~a~~~g~~v~~~~~~s~~~~~~~  277 (398)
                      ..+++.+.+.+++|+||+....  .      ....+++++.++.++++.||+++.+.+|...|+|+.++.|+++++++|.
T Consensus       154 ~~~~~~~~~~~~iv~N~~~~~~--~------~~~~~~i~~~~~~~~~~~IP~d~~~~~a~~~g~p~~~~~p~s~~a~~~~  225 (232)
T d1hyqa_         154 IVAERLGTKVLGVVVNRITTLG--I------EMAKNEIEAILEAKVIGLIPEDPEVRRAAAYGKPVVLRSPNSPAARAIV  225 (232)
T ss_dssp             HHHHHHTCEEEEEEEEEECTTT--H------HHHHHHHHHHTTSCEEEEEECCHHHHHHHHHTSCHHHHCTTSHHHHHHH
T ss_pred             hhhhhccccccccccccccccc--c------cchhhhHHhhcCCeEEEECCCCHHHHHHHHCCceEEEECCCCHHHHHHH
Confidence            9999999999999999953221  1      1245778888999999999999999999999999999999999999999


Q ss_pred             HHHHHH
Q 015919          278 DLGVCV  283 (398)
Q Consensus       278 ~la~~i  283 (398)
                      +||++|
T Consensus       226 ~lA~~i  231 (232)
T d1hyqa_         226 ELANYI  231 (232)
T ss_dssp             HHHHHH
T ss_pred             HHHHHh
Confidence            999987



>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g0ta1 c.37.1.10 (A:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2auwa2 d.331.1.1 (A:4-87) Hypothetical protein NE0471 N-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure