Citrus Sinensis ID: 015948


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MAEVDLSKKVADRYLKREVLGEGTYGVVYKAIDTKTGQTVAIKKIRLGKQKEGVNFTALREIKLLKELKSPHIIELIDAFPHKGNLHLVFEFMETDLETVIRNTNIFLSPADIKSYMQMTLKGLAFCHKKWVLHRDMKPNNLLIGSHGQLKLADFGLARIFGSPDRRFTHQVFARWYRAPELLFGAKQYGAGVDVWAAGCIFAELLNRRPFLQGSSDIDQLGKIFAAFGTATPSQWPDLAYLPDYVEYQYVAAPPLRSLFPSASDDALDLLSKMFTYDPKARITAQQALEHRYFSSAPLPTEPNKLPRPATKRASKASDFNPQEGPTVLSPPRKTRRVMPDREGFEGNANRTDKIEEHAGETKNADGEIAGRNEQVPTSVDFSIFAARPPSRPTINR
cccccccHHHHHHHHHccEEcccccEEEEEEEEcccccEEEEEEEcccccccccccHHHHHHHHHHcccccccCEEEEEEECccCEEEEEEccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEcccccccccccccccccccEEEEEccccHHcccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccHHcccccccHHHHHHHHHcccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**********ADRYLKREVLGEGTYGVVYKAIDTKTGQTVAIKKIRLGKQKEGVNFTALREIKLLKELKSPHIIELIDAFPHKGNLHLVFEFMETDLETVIRNTNIFLSPADIKSYMQMTLKGLAFCHKKWVLHRDMKPNNLLIGSHGQLKLADFGLARIFGSPDRRFTHQVFARWYRAPELLFGAKQYGAGVDVWAAGCIFAELLNRRPFLQGSSDIDQLGKIFAAFGTATPSQWPDLAYLPDYVEYQYVAAPPLRSLFPSASDDALDLLSKMFTYDPKARITAQQALEHRYFSSAPLPTE***********************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEVDLSKKVADRYLKREVLGEGTYGVVYKAIDTKTGQTVAIKKIRLGKQKEGVNFTALREIKLLKELKSPHIIELIDAFPHKGNLHLVFEFMETDLETVIRNTNIFLSPADIKSYMQMTLKGLAFCHKKWVLHRDMKPNNLLIGSHGQLKLADFGLARIFGSPDRRFTHQVFARWYRAPELLFGAKQYGAGVDVWAAGCIFAELLNRRPFLQGSSDIDQLGKIFAAFGTATPSQWPDLAYLPDYVEYQYVAAPPLRSLFPSASDDALDLLSKMFTYDPKARITAQQALEHRYFSSAPLPTEPNKLPRPATKRASKASDFNPQEGPTVLSPPRKTRRVMPDREGFEGNANRTDKIEEHAGETKNADGEIAGRNEQVPTSVDFSIFAARPPSRPTINR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclin-dependent kinase D-3 May form a stable complex with cyclin CYCH1-1 that phosphorylates human CDK2 and the C-terminal domain (CTD) of the large subunit of RNA polymerase II.confidentQ9LMT0
Cyclin-dependent kinase D-1 CDK-activating kinase that may control G1/S phase progression. May control the rate of cell differentiation to accomplish proper development of organs, or in response to a changing environment. Forms a complex with cyclin CYCH1-1 that phosphorylates CDKA-1 and the C-terminal domain (CTD) of the large subunit of RNA polymerase II.confidentP29620
Cyclin-dependent kinase D-1 probableA2Y4B6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.22Cyclin-dependent kinase.probable
2.7.11.23Transferred entry: 2.7.11.23.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UA2, chain A
Confidence level:very confident
Coverage over the Query: 15-304
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:very confident
Coverage over the Query: 1-224,246-313
View the alignment between query and template
View the model in PyMOL