Citrus Sinensis ID: 015966


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MNSYFIFAMLQAFDPPLDMSQDMDICEDSHVSHTHYDNQSDGRNVCSGHSTSSSGRMCCSKGDHADCNEQSKVVETAKEMTTNEEEETEGPIEYKTASCPGKLENREETNQSCSNDFTDSNGNASSPACDWLDPSIQLNVPLADVDKVRCIIRNIVRDWAAEGKTERDQCYKPILEELDALFPNRSKESPPACLVPGAGLGRLALEISHLGFISQGNEFSYYMMICSSFILNHTETAGEWNIYPWIHSNCNSLSDSDQLRPVSIPDIHPASAGITEGFSMCGGDFVEVYSDPSQVGAWDAVVTCFFIDTAHNIVEYIEIISRILKDGGVWINLGPLLYHFADLYGQEDEMSIELSLEDVKRVALHYGFEFEKEKTIETTYTTNPRSMMQVSFLPCTL
ccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHccccccccccccccccHHcHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHcccCEEECcHHHHHHHHHHHHHHcccccccEEEEcccccccccccccccCEEEEcccccccccccccccEEEcccccccccccccccccCEEEEEEEHccHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccHHHHHHHHHHcccEEEEEEEECcccccccccccccccccccc
*NSYFIFAMLQAFDPPLDMSQDMDICE*******************************CSKG**************************************GKLENREETNQSCSNDFTDSN*************SIQLNVPLADVDKVRCIIRNIVRDWAAEGKTERDQCYKPILEELDALFPNRSKESPPACLVPGAGLGRLALEISHLGFISQGNEFSYYMMICSSFILNHTETAGEWNIYPWIHSNCNSLSDSDQLRPVSIPDIHPASAGITEGFSMCGGDFVEVYSDPSQVGAWDAVVTCFFIDTAHNIVEYIEIISRILKDGGVWINLGPLLYHFADLYGQEDEMSIELSLEDVKRVALHYGFEFEKEKTIETTYTTNPRSMMQVSFLPCTL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSYFIFAMLQAFDPPLDMSQDMDICEDSHVSHTHYDNQSDGRNVCSGHSTSSSGRMCCSKGDHADCNEQSKVVETAKEMTTNEEEETEGPIEYKTASCPGKLENREETNQSCSNDFTDSNGNASSPACDWLDPSIQLNVPLADVDKVRCIIRNIVRDWAAEGKTERDQCYKPILEELDALFPNRSKESPPACLVPGAGLGRLALEISHLGFISQGNEFSYYMMICSSFILNHTETAGEWNIYPWIHSNCNSLSDSDQLRPVSIPDIHPASAGITEGFSMCGGDFVEVYSDPSQVGAWDAVVTCFFIDTAHNIVEYIEIISRILKDGGVWINLGPLLYHFADLYGQEDEMSIELSLEDVKRVALHYGFEFEKEKTIETTYTTNPRSMMQVSFLPCTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UPF0586 protein C9orf41 homolog probableQ5BJZ6
UPF0586 protein C9orf41 homolog probableQ80UY1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I62, chain A
Confidence level:confident
Coverage over the Query: 189-381
View the alignment between query and template
View the model in PyMOL
Template: 2A14, chain A
Confidence level:confident
Coverage over the Query: 172-375
View the alignment between query and template
View the model in PyMOL
Template: 2AOT, chain A
Confidence level:confident
Coverage over the Query: 143-238,258-262,277-371
View the alignment between query and template
View the model in PyMOL