Citrus Sinensis ID: 015967

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MEQQHSGCRDAEAVLNLQQNSSISIAYHPLFGPNDDLILLELDEKLLSDVLYQRVSLRGQPDEDAVLCTQSKTFAIKFVGTSNSVFLIPPSDHSSFCEIADDCSGKNRNQQSIASVIKVAPGNMELVEVAPRIDKLKLLLSENPYSSEEALEFEDLEEMEKSKAGLYTWNDLVDKVQASDDELRSGLWALSAVELGGYWRIVDERYMGTVLAMLLHNSVLNDWSLDALIEDEVVNVLVSDGFPPILASHCLRVYGSKVDENRSKSCLWKLDEKRVCVHFAREILSSGRRKMESFMEEWQRKIPEGMQASFEILEGEVLTERLGVDLWIRAFSVSSLPANPAERFSILFGERPKWEWKDLQPYIRDLKVPGQSLEGLLLKYTRRTQPTLDAEPVYSAR
ccHHHHHHHHHHHHHHHcccccEEEEEcccccccccEEEEEccHHHHHHHccccEEEEccccccEEEEcccccEEEEEEccccEEEEEccccccccccccccccccccccccccEEEEECccEEEEECccccHHHHHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHHHHHccHHHHHHHHHHcccEEEccEEEEccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHccccccccccccEEECcHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccEEEEEEccccccEEEEEEcccccccHHHHHHHHHHccccccccccHHHHHccccccccHHHHHHHHHHcccccccccEEECcc
*******CRDAEAVLNLQQNSSISIAYHPLFGPNDDLILLELDEKLLSDVLYQRVSLRGQPDEDAVLCTQSKTFAIKFVGTSNSVFLIPPSDHSSFCEIA*D*********SIASVIKVAPGNMELVEVAPRIDKLKLLLSENPYSSEEA**************GLYTWNDLVDKVQASDDELRSGLWALSAVELGGYWRIVDERYMGTVLAMLLHNSVLNDWSLDALIEDEVVNVLVSDGFPPILASHCLRVYGSKVDENRSKSCLWKLDEKRVCVHFAREILSSGRRKMESFMEEWQRKIPEGMQASFEILEGEVLTERLGVDLWIRAFSVSSLPANPAERFSILFGERPKWEWKDLQPYIRDLKVPGQSLEGLLLKYTRRTQP*LDA*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQQHSGCRDAEAVLNLQQNSSISIAYHPLFGPNDDLILLELDEKLLSDVLYQRVSLRGQPDEDAVLCTQSKTFAIKFVGTSNSVFLIPPSDHSSFCEIADDCSGKNRNQQSIASVIKVAPGNMELVEVAPRIDKLKLLLSENPYSSEEALEFEDLEEMEKSKAGLYTWNDLVDKVQASDDELRSGLWALSAVELGGYWRIVDERYMGTVLAMLLHNSVLNDWSLDALIEDEVVNVLVSDGFPPILASHCLRVYGSKVDENRSKSCLWKLDEKRVCVHFAREILSSGRRKMESFMEEWQRKIPEGMQASFEILEGEVLTERLGVDLWIRAFSVSSLPANPAERFSILFGERPKWEWKDLQPYIRDLKVPGQSLEGLLLKYTRRTQPTLDAEPVYSAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sister chromatid cohesion protein DCC1 Loads pcna onto primed templates regulating velocity, spacing and restart activity of replication forks. May couple DNA replication to sister chromatid cohesion.probableQ66I84
Sister chromatid cohesion protein DCC1 Loads PCNA onto primed templates regulating velocity, spacing and restart activity of replication forks. May couple DNA replication to sister chromatid cohesion through regulation of the acetylation of the cohesin subunit SMC3.probableQ14AI0
Sister chromatid cohesion protein DCC1 Loads pcna onto primed templates regulating velocity, spacing and restart activity of replication forks. May couple DNA replication to sister chromatid cohesion.probableQ6GL75

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!