Citrus Sinensis ID: 016026


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHGRGKSHGSVHELHDQPVVIQNSRWAGLPPELLRDVIKRLEASESTWPARKHVVACAAVCRSWREMCKEIVRNPEFSGKITFPVSLKQPGPRDGTIQCFIKRDKSNLTYHLFLCLSPDNISRSSSTYIGKLRSNFLGTKFIIYDTQPPYNSAQLSPPGRSRRFYSKKVSPKVPTGSYNIAQVSYELNVLGTRGPRRMHCTMHSIPASALEPGGSVPGQAELNPRSLEDSFRNFSKSIDVSTEFSSSRFSDIVGPRDEEDEGKDRPLILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPPPPPPSDHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
cccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccEEEEcccccccEEEEEEccccccccccccccccccccccccCEEEEEEEccccccEEEEEEccccccccccccEEEEEcccccccEEEEEcccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccEEEEccccEEccccccEEEECccccccccccccccccccccccccCEEEEEcccccEEEEEEcccccHHHHHHHHHHHcccccccc
*SFRSIVRDVRDGF*******************************P*VIQNSRWAGLPPELLRDVIKRLEASESTWPARKHVVACAAVCRSWREMCKEIVRNPEFSGKITFPVSLKQPGPRDGTIQCFIKRDKSNLTYHLFLCLSPDNISRSSSTYIGKLRSNFLGTKFIIYDTQPPY******************VS****TGSYNIAQVSYELNVLGTRGPRRMHCTMHSIPA*********************************************************RPLILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQ****************SDHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFRSIVRDVRDGFGSLSRRSFEVRLPGHHGRGKSHGSVHELHDQPVVIQNSRWAGLPPELLRDVIKRLEASESTWPARKHVVACAAVCRSWREMCKEIVRNPEFSGKITFPVSLKQPGPRDGTIQCFIKRDKSNLTYHLFLCLSPDNISRSSSTYIGKLRSNFLGTKFIIYDTQPPYNSAQLSPPGRSRRFYSKKVSPKVPTGSYNIAQVSYELNVLGTRGPRRMHCTMHSIPASALEPGGSVPGQAELNPRSLEDSFRNFSKSIDVSTEFSSSRFSDIVGPRDEEDEGKDRPLILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPPPPPPSDHDKIILQFGKVGKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tubby-like F-box protein 14 confidentQ2QXB2
Tubby-like F-box protein 1 probableQ9ZP59

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FIM, chain A
Confidence level:very confident
Coverage over the Query: 113-181,197-273,288-332,351-390
View the alignment between query and template
View the model in PyMOL
Template: 1C8Z, chain A
Confidence level:confident
Coverage over the Query: 117-191,207-260,275-333,352-396
View the alignment between query and template
View the model in PyMOL
Template: 1FS1, chain A
Confidence level:confident
Coverage over the Query: 54-97
View the alignment between query and template
View the model in PyMOL