Citrus Sinensis ID: 016090

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----

MEDNEVETSEWVGSPGLTNISNGPFHTPVSAKGGRVNNRSKGIKGNRSTPQTPVSNAGSPSALTPAGSCRYDSSLGLLTKKFINLIKHAEDGILDLNKAAETLEVQKRRIYDITNVLEGIGLIEKKLKNRIRWKGLDNSIPGEVDADASILQADIDNLSMEELRVDEQTRELRERLRELIENENNRKWLFVTEEDIKNLHCFQNQTLIAIKAPQGTTLEVPDPDEAVDYPQRRYRIILRSTMGPIDVYLVSRFEEKFEETNSVEPPASVPPVSSSDSNENQVKEIINVDRAGNETEAQAQQAHQIYSDLNSSQEVVGGMMKIVPSDVDNDADYWLLSDADVSITDMWKTDSGAEWDGVNMLHAEFGMSDACTPTPQTPPSRITEVPSTDFNPIHR

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHEEEEEHHHHHcccHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcccccccEEEEEEcccccEEECccccccccccccEEEEEEEcccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

********************************************************************CRYDSSLGLLTKKFINLIKHAEDGILDLNKAAETLEVQKRRIYDITNVLEGIGLIEKKLKNRIRWKGLDNSIP****************************R*********IENENNRKWLFVTEEDIKNLHCFQNQTLIAIKAPQGTTLEVPDPDEAVDYPQRRYRIILRSTMGPIDVYLVSRF*************************************************************VVGGMMKIVPSDVDNDADYWLLSDADVSITDMWKTDSGAEWDGVNMLHAEFG*****************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEDNEVETSEWVGSPGLTNISNGPFHTPVSAKGGRVNNRSKGIKGNRSTPQTPVSNAGSPSALTPAGSCRYDSSLGLLTKKFINLxxxxxxxxxxxxxxxxxxxxxKRRIYDITNVLEGIGLIEKKLKNRIRWKGLDNSIPGEVDADASILQADIDNLSMEELRxxxxxxxxxxxxxxxxxxxxxxKWLFVTEEDIKNLHCFQNQTLIAIKAPQGTTLEVPDPDEAVDYPQRRYRIILRSTMGPIDVYLVSRFEEKFEETNSVEPPASVPPVSSSDSNENQVKEIINVDRAGNETEAQAQQAHQIYSDLNSSQEVVGGMMKIVPSDVDNDADYWLLSDADVSITDMWKTDSGAEWDGVNMLHAEFGMSDACTPTPQTPPSRITEVPSTDFNPIHR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor E2FA	Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The binding of retinoblastoma-related proteins represses transactivation. Regulates gene expression both positively and negatively. Activates the expression of E2FB. Involved in the control of cell-cycle progression from G1 to S phase. Stimulates cell proliferation and delays differentiation.	probable	Q9FNY0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AZE, chain B
Confidence level:very confident
Coverage over the Query: 146-252
View the alignment between query and template
View the model in PyMOL

Template: 1CF7, chain A
Confidence level:very confident
Coverage over the Query: 69-134
View the alignment between query and template
View the model in PyMOL