Citrus Sinensis ID: 016137

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MGKQNKGLFSSLLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESGTLKRNLQLPLPWKFRGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSCSGDTDAILPLTATRYSIGSLKLETNISWYAWLDDHFQVSDYISSW
cccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEEccccccEEEEEEEEEccccccccccEEEEEcccccccccHHHHHHHcccEEEccccccccccccccccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHcccccccccccEEEEEEEccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHccccccccccEEEEccccccccccHHHHHHHHHcccccccccccccccccEEEEEEEEc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHcHHHcEccccccccccccccEEEEEEEEEccccEEEEEEEEEccccccHHHccEEEEEcccccEcccccHHHHccccEEEcHHHccEEEccccHHHccEEEEEcccccccccEEccHHHHHcccHHHHHHHHHHHHHHHHHHcHHHcccEEEEEEEccHHHHHHHHHHHHHHHcccccEcccEEEEEEEEccccEHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHccccccccEEEEEEcccccccHHHHHHHHHcccccEEEEEEEEEEcccEEEEEEEEc
MGKQNKGLFSSLLCVLGLAIvlfpspvsaiFKEQEKDriiklpgqppnvnfsqysgyitvdRKAGRALFYWLVeapvdrqpaskplvlwlnggpgcssvaygaseevgpfrvrrdgkrlklnpyawnkeanilfldspagvgfsytktrediytvgdkrtgkdAYTFLVNWFvrfpqykhrpfylagesyaghyipeLCQVIVRGnkgvknpiinfkgfllgnpliddyfdnigtheywwnhglisdstyqdlkkfcphetflfpkneCESALSRAYsefadvnpysiysspcfesgtlkrnlqlplpwkfrgvdeCVVKYTKVYMNRLDVQKALHADaslinhpwgscsgdtdailpltatrysigslkletniswYAWLDDHFQVSDYISSW
MGKQNKGLFSSLLCVLGLAIVLFPSPVSAIFKEQEKDRiiklpgqppnvnfsqYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYgaseevgpfrvrrdgkrlklnpyawnkeanilfldspagVGFSYTKTREdiytvgdkrtgkDAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESGTLKRNLQLPLPWKFRGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSCSGDTDAILPLTATRYSIGSLKLETNISWYAWLDDHFQVSDYISSW
MGKQNKGLFSSLLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESGTLKRNLQLPLPWKFRGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSCSGDTDAILPLTATRYSIGSLKLETNISWYAWLDDHFQVSDYISSW
*******LFSSLLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESGTLKRNLQLPLPWKFRGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSCSGDTDAILPLTATRYSIGSLKLETNISWYAWLDDHFQVSDYI***
***********LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESGTL*****LPLPWKFRGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSCSGDTDAILPLTATRYSIGSLKLETNISWYAWLDDHFQVSDYISSW
MGKQNKGLFSSLLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESGTLKRNLQLPLPWKFRGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSCSGDTDAILPLTATRYSIGSLKLETNISWYAWLDDHFQVSDYISSW
*G*QNKGLFSSLLCVLGLAIVLFPSPVSAIF*EQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESG********PLPWKFRGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSCSGDTDAILPLTATRYSIGSLKLETNISWYAWLDDHFQVSDYISSW
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKQNKGLFSSLLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESGTLKRNLQLPLPWKFRGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSCSGDTDAILPLTATRYSIGSLKLETNISWYAWLDDHFQVSDYISSW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query394 2.2.26 [Sep-21-2011]
Q8S8K6462 Serine carboxypeptidase-l yes no 0.928 0.792 0.567 1e-128
Q9SFB5459 Serine carboxypeptidase-l no no 0.901 0.773 0.555 1e-125
Q9ZQQ0452 Serine carboxypeptidase-l no no 0.880 0.767 0.527 1e-114
P08819444 Serine carboxypeptidase 2 N/A no 0.873 0.774 0.519 1e-108
P08818476 Serine carboxypeptidase 2 N/A no 0.873 0.722 0.525 1e-108
Q9M099465 Serine carboxypeptidase 2 no no 0.944 0.8 0.449 1e-100
Q8L9Y0473 Serine carboxypeptidase-l no no 0.949 0.790 0.444 2e-99
Q1PF08464 Serine carboxypeptidase-l no no 0.888 0.754 0.455 1e-98
P55748436 Serine carboxypeptidase I N/A no 0.885 0.800 0.452 9e-95
O82229454 Putative serine carboxype no no 0.885 0.768 0.455 4e-93
>sp|Q8S8K6|SCP28_ARATH Serine carboxypeptidase-like 28 OS=Arabidopsis thaliana GN=SCPL28 PE=2 SV=2 Back     alignment and function desciption
 Score =  457 bits (1176), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 230/405 (56%), Positives = 278/405 (68%), Gaps = 39/405 (9%)

Query: 13  LCVLGLAIVLFPSPVSAIFKEQE-KDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW 71
           +C+L + I L     S   KEQ+ KD+II LPGQPPN+NFSQ+SGY+TVD  AGRALFYW
Sbjct: 11  MCLLCMVIALLDVVSSDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFYW 70

Query: 72  LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEAN 131
           L EAP  R   +KPLVLWLNGGPGCSS+AYGASEEVGPFRV  DGK L+LN YAWNK AN
Sbjct: 71  LTEAP--RPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVAN 128

Query: 132 ILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYA 191
           +LFLDSPAGVGFSYT T  D  TVGDKRTG+DAY FLV W  RFP+YK R FY+AGESYA
Sbjct: 129 VLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYIAGESYA 188

Query: 192 GHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQ 251
           GHYIPEL Q+IV  NKG KNP IN KG L+GNPL+DDY DN G  +YWWNHGLISD +Y 
Sbjct: 189 GHYIPELAQLIVNRNKGAKNPTINLKGILMGNPLVDDYNDNKGMRDYWWNHGLISDESYN 248

Query: 252 DLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESGTLKRNLQLPLPWKF 311
           DL K+C +++ LFPK  C +AL++A SEF D++PY+I S  C    +    +Q    W++
Sbjct: 249 DLTKWCLNDSILFPKLNCNAALNQALSEFGDIDPYNINSPACTTHASSNEWMQ---AWRY 305

Query: 312 RGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSC---------------------- 349
           RG DECVV YT+ YMN  +V K+ HA  +  + PW  C                      
Sbjct: 306 RGNDECVVGYTRKYMNDPNVHKSFHARLN-GSTPWTPCSRVIRKNWKDSPKSMLPIIKNL 364

Query: 350 ----------SGDTDAILPLTATRYSIGSLKLETNISWYAWLDDH 384
                     SGD+DA+LPL+ TR+SI ++KL+++  WY W   H
Sbjct: 365 LQAHLRIWIFSGDSDAVLPLSGTRHSINAMKLKSSKRWYPWYHSH 409
Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q9SFB5|SCP27_ARATH Serine carboxypeptidase-like 27 OS=Arabidopsis thaliana GN=SCPL27 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQQ0|SCP26_ARATH Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1 Back     alignment and function description
>sp|P08819|CBP2_WHEAT Serine carboxypeptidase 2 OS=Triticum aestivum GN=CBP2 PE=1 SV=2 Back     alignment and function description
>sp|P08818|CBP2_HORVU Serine carboxypeptidase 2 OS=Hordeum vulgare GN=CBP2 PE=1 SV=2 Back     alignment and function description
>sp|Q9M099|SCP24_ARATH Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1 Back     alignment and function description
>sp|Q8L9Y0|SCP25_ARATH Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2 Back     alignment and function description
>sp|Q1PF08|SCP22_ARATH Serine carboxypeptidase-like 22 OS=Arabidopsis thaliana GN=SCPL22 PE=2 SV=1 Back     alignment and function description
>sp|P55748|CBP22_HORVU Serine carboxypeptidase II-2 (Fragment) OS=Hordeum vulgare GN=CXP;2-2 PE=1 SV=1 Back     alignment and function description
>sp|O82229|SCP23_ARATH Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana GN=SCPL23 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query394
224109736467 predicted protein [Populus trichocarpa] 0.954 0.805 0.702 1e-164
224100809466 predicted protein [Populus trichocarpa] 0.954 0.806 0.676 1e-161
296086043483 unnamed protein product [Vitis vinifera] 0.987 0.805 0.638 1e-155
225449098472 PREDICTED: serine carboxypeptidase-like 0.987 0.824 0.638 1e-155
255588259385 serine carboxypeptidase, putative [Ricin 0.885 0.906 0.728 1e-148
225449100456 PREDICTED: serine carboxypeptidase-like 0.908 0.785 0.556 1e-131
224100813460 predicted protein [Populus trichocarpa] 0.911 0.780 0.572 1e-130
224109732460 predicted protein [Populus trichocarpa] 0.946 0.810 0.561 1e-130
147811946452 hypothetical protein VITISV_028701 [Viti 0.918 0.800 0.554 1e-130
356533977472 PREDICTED: serine carboxypeptidase-like 0.923 0.771 0.547 1e-128
>gi|224109736|ref|XP_002315293.1| predicted protein [Populus trichocarpa] gi|222864333|gb|EEF01464.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  583 bits (1502), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 291/414 (70%), Positives = 322/414 (77%), Gaps = 38/414 (9%)

Query: 11  SLLCVLGLAIVLFPSPVSAI----FKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGR 66
           SLL VL LA +L  S ++A      +EQ +D+IIKL GQPPNV+FSQ+SGYITVD  AGR
Sbjct: 9   SLLYVLNLATLLL-STIAATNHGHLEEQRRDKIIKLQGQPPNVSFSQFSGYITVDPLAGR 67

Query: 67  ALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAW 126
           ALFYWL+EAP   +P SKPLVLWLNGGPGCSSVAYGASEEVGPFRVR DGK L LNPYAW
Sbjct: 68  ALFYWLIEAPKIVKPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPYAW 127

Query: 127 NKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLA 186
           NK AN+LFLDSPAGVGFSY+ T  D YTVGDKRT KDAYTFLVNWF RF QYKHRPFY+A
Sbjct: 128 NKVANLLFLDSPAGVGFSYSNTSSDTYTVGDKRTAKDAYTFLVNWFERFTQYKHRPFYIA 187

Query: 187 GESYAG-HYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLI 245
           GESYAG HYIPEL ++I R NKGVKNP+INF GFLLGNPLIDDY DN+GTHE+WWNHGLI
Sbjct: 188 GESYAGGHYIPELSRIIARRNKGVKNPVINFTGFLLGNPLIDDYHDNVGTHEFWWNHGLI 247

Query: 246 SDSTYQDLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESGTLKRNLQL 305
           SDSTY+DLKKFCP+ TFLFPK+EC SAL RAYSEF D+NPYSIYSSPC E  TL+  L  
Sbjct: 248 SDSTYKDLKKFCPNSTFLFPKSECNSALKRAYSEFGDINPYSIYSSPCNEIITLRHYLNY 307

Query: 306 PLPWKFRGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSCS--------------- 350
            LPWKFRG DECVV YTK YMNR +VQ+ALHA+ + I HPW +CS               
Sbjct: 308 SLPWKFRGNDECVVMYTKRYMNRPEVQRALHANITRIPHPWATCSSIVRRNWSDSPKSML 367

Query: 351 -----------------GDTDAILPLTATRYSIGSLKLETNISWYAWLDDHFQV 387
                            GDTDAILPLTATRYSI +L+L+TNISWYAW DDH QV
Sbjct: 368 PIFKELIAAGIRIWVFSGDTDAILPLTATRYSINALQLQTNISWYAWHDDHHQV 421

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224100809|ref|XP_002312023.1| predicted protein [Populus trichocarpa] gi|222851843|gb|EEE89390.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296086043|emb|CBI31484.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449098|ref|XP_002274699.1| PREDICTED: serine carboxypeptidase-like 28-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255588259|ref|XP_002534550.1| serine carboxypeptidase, putative [Ricinus communis] gi|223525058|gb|EEF27834.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225449100|ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera] gi|296086044|emb|CBI31485.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224100813|ref|XP_002312024.1| predicted protein [Populus trichocarpa] gi|222851844|gb|EEE89391.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224109732|ref|XP_002315292.1| predicted protein [Populus trichocarpa] gi|222864332|gb|EEF01463.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147811946|emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356533977|ref|XP_003535534.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query394
TAIR|locus:2058734462 scpl28 "serine carboxypeptidas 0.842 0.718 0.628 2.7e-124
TAIR|locus:2077422459 SCPL27 "serine carboxypeptidas 0.865 0.742 0.587 6.8e-111
TAIR|locus:2039275452 scpl26 "serine carboxypeptidas 0.822 0.716 0.564 7.7e-103
TAIR|locus:2078598473 scpl25 "serine carboxypeptidas 0.873 0.727 0.484 2.3e-99
TAIR|locus:2061436464 scpl22 "serine carboxypeptidas 0.847 0.719 0.487 1.4e-97
TAIR|locus:2166870499 SCPL34 "serine carboxypeptidas 0.677 0.535 0.512 3.3e-93
TAIR|locus:2118706465 BRS1 "BRI1 SUPPRESSOR 1" [Arab 0.845 0.716 0.501 2.5e-90
TAIR|locus:2126644479 scpl29 "serine carboxypeptidas 0.847 0.697 0.463 3.4e-90
TAIR|locus:2008480463 SCPL32 "serine carboxypeptidas 0.819 0.697 0.472 1.2e-85
TAIR|locus:2181504480 scpl35 "serine carboxypeptidas 0.855 0.702 0.423 7.4e-80
TAIR|locus:2058734 scpl28 "serine carboxypeptidase-like 28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1131 (403.2 bits), Expect = 2.7e-124, Sum P(2) = 2.7e-124
 Identities = 213/339 (62%), Positives = 252/339 (74%)

Query:    13 LCVLGLAIVLFPSPVSAIFKEQE-KDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW 71
             +C+L + I L     S   KEQ+ KD+II LPGQPPN+NFSQ+SGY+TVD  AGRALFYW
Sbjct:    11 MCLLCMVIALLDVVSSDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFYW 70

Query:    72 LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEAN 131
             L EAP  R   +KPLVLWLNGGPGCSS+AYGASEEVGPFRV  DGK L+LN YAWNK AN
Sbjct:    71 LTEAP--RPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVAN 128

Query:   132 ILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYA 191
             +LFLDSPAGVGFSYT T  D  TVGDKRTG+DAY FLV W  RFP+YK R FY+AGESYA
Sbjct:   129 VLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYIAGESYA 188

Query:   192 GHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQ 251
             GHYIPEL Q+IV  NKG KNP IN KG L+GNPL+DDY DN G  +YWWNHGLISD +Y 
Sbjct:   189 GHYIPELAQLIVNRNKGAKNPTINLKGILMGNPLVDDYNDNKGMRDYWWNHGLISDESYN 248

Query:   252 DLKKFCPHETFLFPKNECESALSRAYSEFADVNPYSIYSSPCFESGTLKRNLQLPLPWKF 311
             DL K+C +++ LFPK  C +AL++A SEF D++PY+I S  C    +    +Q    W++
Sbjct:   249 DLTKWCLNDSILFPKLNCNAALNQALSEFGDIDPYNINSPACTTHASSNEWMQA---WRY 305

Query:   312 RGVDECVVKYTKVYMNRLDVQKALHADASLINHPWGSCS 350
             RG DECVV YT+ YMN  +V K+ HA  +  + PW  CS
Sbjct:   306 RGNDECVVGYTRKYMNDPNVHKSFHARLNG-STPWTPCS 343
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
TAIR|locus:2077422 SCPL27 "serine carboxypeptidase-like 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039275 scpl26 "serine carboxypeptidase-like 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078598 scpl25 "serine carboxypeptidase-like 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061436 scpl22 "serine carboxypeptidase-like 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166870 SCPL34 "serine carboxypeptidase-like 34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118706 BRS1 "BRI1 SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126644 scpl29 "serine carboxypeptidase-like 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008480 SCPL32 "serine carboxypeptidase-like 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181504 scpl35 "serine carboxypeptidase-like 35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8S8K6SCP28_ARATH3, ., 4, ., 1, 6, ., -0.56790.92890.7922yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.160.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.X.2590.1
hypothetical protein (434 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
pfam00450415 pfam00450, Peptidase_S10, Serine carboxypeptidase 1e-136
PLN02209437 PLN02209, PLN02209, serine carboxypeptidase 7e-43
PLN03016433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 2e-39
COG2939498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 1e-37
PTZ00472462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 1e-37
PLN02213319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 1e-25
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information 
 Score =  394 bits (1015), Expect = e-136
 Identities = 153/376 (40%), Positives = 194/376 (51%), Gaps = 47/376 (12%)

Query: 43  PGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYG 102
           PG    + F QYSGY+TVD  AGR+LFYW  E+  +  P + PLVLWLNGGPGCSS+  G
Sbjct: 1   PGLDGPLPFKQYSGYLTVDESAGRSLFYWFFES--ENNPENDPLVLWLNGGPGCSSL-GG 57

Query: 103 ASEEVGPFRVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGK 162
             EE+GPFRV   G  L LNPY+WNK AN+LFLD P GVGFSY+ T  D  T  D+ T K
Sbjct: 58  LFEELGPFRVN-SGPTLYLNPYSWNKVANVLFLDQPVGVGFSYSNTTSDYKT-DDEETAK 115

Query: 163 DAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPIINFKGFLLG 222
           D Y FL  +F +FP+YK+ PFY+AGESYAGHY+P L Q I+ GNK    P IN KG L+G
Sbjct: 116 DNYEFLQKFFEKFPEYKNNPFYIAGESYAGHYVPALAQEILDGNKKGTGPNINLKGVLIG 175

Query: 223 NPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETF--LFPKNECESAL---SRAY 277
           N L D          + + HGLISD  Y+ LKK C  +         +C + +   S   
Sbjct: 176 NGLTDPAIQYNSYIPFAYYHGLISDELYESLKKACCGKYPDCDPANTKCLNLVEEASGCN 235

Query: 278 SEFADVNPYSIYSSPCFESGTLKRNLQLPLPWKFRGVDECVVKYTKVYMNRLDVQKALHA 337
           +    +NPY+IY+  C+ S     +L         G D     Y + Y+NR DV+KALHA
Sbjct: 236 AYNGGINPYNIYTPCCYNS---SLSLNPSSTDSCGGYDCYDESYVEKYLNRPDVRKALHA 292

Query: 338 DASLINHPWGSC---------------------------------SGDTDAILPLTATRY 364
           +   +   W  C                                 SGD D I     T+ 
Sbjct: 293 NKGSV-GEWSRCNDEVFNWYGDDISKSMLPILPKLLEGGLRVLIYSGDHDLICNFLGTQA 351

Query: 365 SIGSLKLETNISWYAW 380
            I +L       +  W
Sbjct: 352 WIDALNWSGKDGFRPW 367

Length = 415
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 394
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PLN02209437 serine carboxypeptidase 100.0
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 100.0
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 100.0
KOG1283414 consensus Serine carboxypeptidases [Posttranslatio 100.0
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 97.92
TIGR03611257 RutD pyrimidine utilization protein D. This protei 97.82
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 97.69
PHA02857276 monoglyceride lipase; Provisional 97.5
PRK10673255 acyl-CoA esterase; Provisional 97.3
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 97.23
PLN02298330 hydrolase, alpha/beta fold family protein 97.21
PRK00870302 haloalkane dehalogenase; Provisional 97.11
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 97.07
PLN02824294 hydrolase, alpha/beta fold family protein 97.06
PLN02385349 hydrolase; alpha/beta fold family protein 97.06
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 97.04
PLN02652395 hydrolase; alpha/beta fold family protein 96.94
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 96.81
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 96.69
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 96.67
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 96.63
PRK06489360 hypothetical protein; Provisional 96.63
PRK05077414 frsA fermentation/respiration switch protein; Revi 96.5
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 96.42
PLN02894402 hydrolase, alpha/beta fold family protein 96.42
PRK03592295 haloalkane dehalogenase; Provisional 96.36
PRK10749330 lysophospholipase L2; Provisional 96.1
PRK03204286 haloalkane dehalogenase; Provisional 96.1
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 95.92
PLN02679360 hydrolase, alpha/beta fold family protein 95.77
PLN02211273 methyl indole-3-acetate methyltransferase 95.66
PLN03084383 alpha/beta hydrolase fold protein; Provisional 95.55
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 95.53
PRK10349256 carboxylesterase BioH; Provisional 95.48
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 95.47
PLN02965255 Probable pheophorbidase 95.33
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 95.31
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 95.31
PRK05855 582 short chain dehydrogenase; Validated 95.17
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 95.12
PLN02511388 hydrolase 95.0
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 95.0
PLN02578354 hydrolase 94.94
PRK10566249 esterase; Provisional 94.8
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 94.8
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 94.57
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 94.57
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 94.46
PLN02442283 S-formylglutathione hydrolase 94.38
PRK10115686 protease 2; Provisional 94.25
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 94.06
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 93.83
COG2267298 PldB Lysophospholipase [Lipid metabolism] 93.8
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 93.66
PRK07581339 hypothetical protein; Validated 93.56
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 93.49
PRK08775343 homoserine O-acetyltransferase; Provisional 93.43
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 93.32
KOG2564343 consensus Predicted acetyltransferases and hydrola 93.16
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 93.03
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 93.0
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 92.74
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 92.36
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 92.27
PRK10985324 putative hydrolase; Provisional 91.59
PLN00021313 chlorophyllase 91.43
KOG1455313 consensus Lysophospholipase [Lipid transport and m 91.41
PRK10162318 acetyl esterase; Provisional 91.34
PRK00175379 metX homoserine O-acetyltransferase; Provisional 91.17
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 90.82
KOG1838409 consensus Alpha/beta hydrolase [General function p 88.47
PLN02872395 triacylglycerol lipase 87.38
PLN02454414 triacylglycerol lipase 86.0
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 84.78
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 84.65
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 83.99
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 83.52
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 83.37
PRK11460232 putative hydrolase; Provisional 81.74
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.6e-103  Score=780.28  Aligned_cols=354  Identities=47%  Similarity=0.874  Sum_probs=320.1

Q ss_pred             cccccccccccCCCCCCCCCcceEEeeEEeccCCCceEEEEEEecCCCCCCCCCCeEEeeCCCCChhhhhhcccccccCE
Q 016137           31 FKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPF  110 (394)
Q Consensus        31 ~~~~~~~~v~~lpg~~~~~~~~~~sGy~~v~~~~~~~lfy~~~es~~~~~~~~~pl~lwlnGGPG~Ss~~~g~~~e~GP~  110 (394)
                      ...+++++|+.|||++.+++|++|||||+|+++.+++||||||||++  +|++|||||||||||||||+ .|+|.|+|||
T Consensus        22 ~~~~~~~~I~~LPG~~~~~~f~~ysGYv~v~~~~~~~LFYwf~eS~~--~P~~dPlvLWLnGGPGCSSl-~G~~~E~GPf   98 (454)
T KOG1282|consen   22 HHVDEADLIKSLPGQPGPLPFKQYSGYVTVNESEGRQLFYWFFESEN--NPETDPLVLWLNGGPGCSSL-GGLFEENGPF   98 (454)
T ss_pred             cccchhhhhhcCCCCCCCCCcccccceEECCCCCCceEEEEEEEccC--CCCCCCEEEEeCCCCCccch-hhhhhhcCCe
Confidence            44567799999999998899999999999999889999999999999  99999999999999999999 5999999999


Q ss_pred             EEecCCCceeeCccCcccCcceeeecCCCCcccccccCCCCccccCcccchHHHHHHHHHHHHHCCCCCCCCeEEecccc
Q 016137          111 RVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESY  190 (394)
Q Consensus       111 ~~~~~~~~l~~n~~sw~~~~n~l~iDqP~g~GfSy~~~~~~~~~~~~~~~a~~~~~fl~~f~~~fp~~~~~~~~i~GeSy  190 (394)
                      +++.+|.+|..|+||||+.||||||||||||||||++++.++.. +|+.+|+|+++||++||++||||++|+|||+||||
T Consensus        99 ~v~~~G~tL~~N~ySWnk~aNiLfLd~PvGvGFSYs~~~~~~~~-~D~~~A~d~~~FL~~wf~kfPey~~~~fyI~GESY  177 (454)
T KOG1282|consen   99 RVKYNGKTLYLNPYSWNKEANILFLDQPVGVGFSYSNTSSDYKT-GDDGTAKDNYEFLQKWFEKFPEYKSNDFYIAGESY  177 (454)
T ss_pred             EEcCCCCcceeCCccccccccEEEEecCCcCCccccCCCCcCcC-CcHHHHHHHHHHHHHHHHhChhhcCCCeEEecccc
Confidence            99999889999999999999999999999999999998888775 89999999999999999999999999999999999


Q ss_pred             cccchHHHHHHHHhhcCCCCCCceeeeeeEecCCCcCccccccccccccccccCCChhHHHHHHhhCCCCC-----CCCC
Q 016137          191 AGHYIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHET-----FLFP  265 (394)
Q Consensus       191 ~G~yvp~la~~i~~~n~~~~~~~inLkGi~IGNg~~dp~~q~~s~~~fa~~~GlIs~~~~~~~~~~C~~~~-----~~~~  265 (394)
                      ||||||+||++|++.|+....+.|||||++||||++|+..|..++.+|+|+|||||+++++.+++.|+...     ....
T Consensus       178 AG~YVP~La~~I~~~N~~~~~~~iNLkG~~IGNg~td~~~~~~~~~~~a~~h~liSde~~~~l~~~C~~~~~~~~~~~~~  257 (454)
T KOG1282|consen  178 AGHYVPALAQEILKGNKKCCKPNINLKGYAIGNGLTDPEIDYNGRIPFAWGHGLISDELYESLKRACDFSSDNYANVDPS  257 (454)
T ss_pred             cceehHHHHHHHHhccccccCCcccceEEEecCcccCccccccchhhhhhhcccCCHHHHHHHHHHhccCcccccccCCc
Confidence            99999999999999997545678999999999999999999999999999999999999999999998742     1233


Q ss_pred             hhHHHHHHHHHH-HhcCCCCCCCCCCCCCCCcccccccccCCCCCccCCCCcccchhHHHhcChHHHHhhhcCCCCCCCc
Q 016137          266 KNECESALSRAY-SEFADVNPYSIYSSPCFESGTLKRNLQLPLPWKFRGVDECVVKYTKVYMNRLDVQKALHADASLINH  344 (394)
Q Consensus       266 ~~~C~~a~~~~~-~~~~~in~Y~i~~~~C~~~~~~~~~~~~~~~~~~~~~~pc~~~~~~~YLN~p~VrkALhV~~~~~~~  344 (394)
                      +.+|.++++.+. ...++++.|+|+.+.|.......     +.++....+++|..++.++|||+|+||+||||+..... 
T Consensus       258 ~~~C~~~~~~~~~~~~~~i~~y~i~~~~C~~~~~~~-----~~~~~~~~~~~c~~~~~~~ylN~~~VrkALh~~~~~~~-  331 (454)
T KOG1282|consen  258 NTKCNKAVEEFDSKTTGDIDNYYILTPDCYPTSYEL-----KKPTDCYGYDPCLSDYAEKYLNRPEVRKALHANKTSIG-  331 (454)
T ss_pred             hhHHHHHHHHHHHHHhccCchhhhcchhhccccccc-----cccccccccCCchhhhHHHhcCCHHHHHHhCCCCCCCC-
Confidence            679999999987 66789999999999998622110     12233467899998888999999999999999865211 


Q ss_pred             cceecc---------------------------------CCCCccCCchhhHHHHHhCCCCCccceeeeeeCCCcEeEEE
Q 016137          345 PWGSCS---------------------------------GDTDAILPLTATRYSIGSLKLETNISWYAWLDDHFQVSDYI  391 (394)
Q Consensus       345 ~W~~cs---------------------------------Gd~D~i~n~~Gt~~wi~~L~w~~~a~~~~W~~~~~qvaGyv  391 (394)
                      +|..||                                 ||+|++||++||++||++|+++..++||||+++++|||||+
T Consensus       332 ~W~~Cn~~v~~~~~~~~~sm~p~~~~~~~~~~~rvliysGD~D~~~p~~gt~~~i~~L~~~~~~~~~pW~~~~~qvaG~~  411 (454)
T KOG1282|consen  332 KWERCNDEVNYNYNDDIKSMLPIHKKLIASGGYRVLIYSGDHDLVVPFLGTQAWIKSLNLSITDEWRPWYHKGGQVAGYT  411 (454)
T ss_pred             cccccChhhhcccccCccchHHHHHHHhhcCceEEEEEeCCcceeCcchhhHHHHHhccCccccCccCCccCCCceeeeE
Confidence            799998                                 99999999999999999999999999999999338999999


Q ss_pred             EEC
Q 016137          392 SSW  394 (394)
Q Consensus       392 ~~Y  394 (394)
                      |+|
T Consensus       412 ~~Y  414 (454)
T KOG1282|consen  412 KTY  414 (454)
T ss_pred             EEe
Confidence            988

>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
1bcr_A263 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 4e-92
1wht_A256 Structure Of The Complex Of L-Benzylsuccinate With 5e-92
1whs_A255 Structure Of The Complex Of L-Benzylsuccinate With 5e-92
3sc2_A259 Refined Atomic Model Of Wheat Serine Carboxypeptida 6e-92
1gxs_A270 Crystal Structure Of Hydroxynitrile Lyase From Sorg 1e-74
1ivy_A452 Physiological Dimer Hpp Precursor Length = 452 8e-40
4az0_A300 Crystal Structure Of Cathepsin A, Complexed With 8a 1e-39
1wpx_A421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 4e-31
1cpy_A421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 1e-29
1ac5_A483 Crystal Structure Of Kex1(delta)p, A Prohormone-pro 3e-25
1bcr_B160 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 1e-13
1wht_B153 Structure Of The Complex Of L-Benzylsuccinate With 1e-13
3sc2_B152 Refined Atomic Model Of Wheat Serine Carboxypeptida 1e-13
1whs_B153 Structure Of The Complex Of L-Benzylsuccinate With 1e-13
1gxs_B158 Crystal Structure Of Hydroxynitrile Lyase From Sorg 5e-07
>pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 Back     alignment and structure 
Iteration: 1

 Score =  334 bits (857), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 161/260 (61%), Positives = 193/260 (74%), Gaps = 7/260 (2%)
Query: 34  QEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGG 93
              DRI +LPGQP  V+F  YSGYITVD  AGR+LFY L EAP D QPA  PLVLWLNGG
Sbjct: 6   HAADRIARLPGQPA-VDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPA--PLVLWLNGG 62
Query: 94  PGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIY 153
           PGCSSVAYGASEE+G FRV+  G  L LN Y WNK AN+LFLDSPAGVGFSYT T  DIY
Sbjct: 63  PGCSSVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIY 122
Query: 154 TVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPI 213
           T GD RT  D+Y FL  WF RFP YK+R FY+AGESYAGHY+PEL Q++ R     KNP+
Sbjct: 123 TSGDNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLVHRS----KNPV 178
Query: 214 INFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETFLFPKNECESAL 273
           IN KGF++GN LIDDY D +GT E+WWNHG++SD TY+ LK+ C H++F+ P   C++A 
Sbjct: 179 INLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHPSPACDAAT 238
Query: 274 SRAYSEFADVNPYSIYSSPC 293
             A +E  +++ YS+Y+  C
Sbjct: 239 DVATAEQGNIDMYSLYTPVC 258
>pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 Back     alignment and structure
>pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 Back     alignment and structure
>pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 Back     alignment and structure
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure
>pdb|1AC5|A Chain A, Crystal Structure Of Kex1(delta)p, A Prohormone-processing Carboxypeptidase From Saccharomyces Cerevisiae Length = 483 Back     alignment and structure
>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 160 Back     alignment and structure
>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 152 Back     alignment and structure
>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|1GXS|B Chain B, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 158 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query394
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 1e-137
1ivy_A452 Human protective protein; carboxypeptidase, serine 1e-133
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 1e-132
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 1e-126
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 1e-115
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 6e-13
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
 Score =  392 bits (1009), Expect = e-137
 Identities = 156/260 (60%), Positives = 188/260 (72%), Gaps = 7/260 (2%)

Query: 34  QEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGG 93
              DRI +LPGQP  V+F  YSGYITVD  AGR+LFY L EAP D      PLVLWLNGG
Sbjct: 1   HAADRIARLPGQPA-VDFDMYSGYITVDEGAGRSLFYLLQEAPED--AQPAPLVLWLNGG 57

Query: 94  PGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIY 153
           PGCSSVAYGASEE+G FRV+  G  L LN Y WNK AN+LFLDSPAGVGFSYT T  DIY
Sbjct: 58  PGCSSVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIY 117

Query: 154 TVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYAGHYIPELCQVIVRGNKGVKNPI 213
           T GD RT  D+Y FL  WF RFP YK+R FY+AGESYAGHY+PEL Q++ R       P+
Sbjct: 118 TSGDNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLVHRSKN----PV 173

Query: 214 INFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHETFLFPKNECESAL 273
           IN KGF++GN LIDDY D +GT E+WWNHG++SD TY+ LK+ C H++F+ P   C++A 
Sbjct: 174 INLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHPSPACDAAT 233

Query: 274 SRAYSEFADVNPYSIYSSPC 293
             A +E  +++ YS+Y+  C
Sbjct: 234 DVATAEQGNIDMYSLYTPVC 253
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query394
1ivy_A452 Human protective protein; carboxypeptidase, serine 100.0
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 100.0
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 100.0
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 99.79
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 99.79
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 99.75
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.1
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 97.93
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 97.84
3llc_A270 Putative hydrolase; structural genomics, joint cen 97.81
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 97.78
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 97.64
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 97.61
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 97.6
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 97.58
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 97.56
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 97.56
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 97.52
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 97.47
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 97.46
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 97.44
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.44
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 97.43
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 97.43
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 97.42
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.41
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 97.41
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 97.39
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 97.39
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 97.39
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 97.38
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 97.38
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 97.36
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 97.34
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 97.33
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 97.32
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 97.32
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 97.31
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 97.31
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 97.3
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 97.28
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 97.24
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 97.23
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 97.23
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.19
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 97.18
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 97.17
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 97.17
3h04_A275 Uncharacterized protein; protein with unknown func 97.17
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 97.16
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 97.16
1iup_A282 META-cleavage product hydrolase; aromatic compound 97.11
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 97.1
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 97.08
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 97.07
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 97.06
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.06
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 97.05
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 97.05
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.03
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 97.02
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 97.01
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 97.01
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 97.0
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 97.0
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.0
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 97.0
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.96
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 96.95
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 96.93
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 96.93
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 96.92
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 96.92
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 96.89
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 96.89
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 96.88
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.87
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 96.87
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 96.87
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 96.85
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 96.84
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 96.82
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 96.81
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 96.81
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 96.8
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 96.78
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 96.78
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.77
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 96.75
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 96.74
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 96.73
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 96.73
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 96.7
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 96.66
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 96.62
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 96.61
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 96.58
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 96.56
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 96.56
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 96.52
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 96.52
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 96.52
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 96.48
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 96.48
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 96.47
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 96.47
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 96.45
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.43
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 96.43
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 96.42
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.42
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 96.4
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 96.4
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.39
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.39
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 96.38
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 96.38
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.37
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 96.36
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 96.35
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 96.32
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 96.32
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 96.31
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 95.3
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 96.28
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 96.27
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 96.23
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 96.17
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 96.12
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 96.1
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 96.1
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 96.1
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 96.08
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.06
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 96.03
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 95.99
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 95.99
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 95.99
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 95.96
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 95.89
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 95.79
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 95.78
1r3d_A264 Conserved hypothetical protein VC1974; structural 95.78
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 95.71
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 95.68
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 95.67
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 95.64
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 95.61
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 95.61
3ain_A323 303AA long hypothetical esterase; carboxylesterase 95.55
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 95.52
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 95.49
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 95.42
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 95.41
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 95.36
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 95.32
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 95.29
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 95.23
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 95.2
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 94.99
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 94.94
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 94.92
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 94.9
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 94.86
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 94.82
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 94.78
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 94.6
1vkh_A273 Putative serine hydrolase; structural genomics, jo 94.44
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 94.19
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 94.08
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 94.02
3tej_A329 Enterobactin synthase component F; nonribosomal pe 93.9
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 93.85
1kez_A300 Erythronolide synthase; polyketide synthase, modul 93.81
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 93.76
3bjr_A283 Putative carboxylesterase; structural genomics, jo 93.76
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 93.36
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 92.85
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 92.82
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 92.75
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 92.72
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 92.71
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 92.6
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 92.44
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 92.39
3nuz_A398 Putative acetyl xylan esterase; structural genomic 92.38
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 92.31
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 92.22
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 92.07
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 91.98
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 91.84
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 91.71
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 91.17
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 90.84
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 90.82
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 90.67
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 89.95
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 89.81
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 89.68
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 89.53
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 89.24
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 89.14
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 88.82
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 88.61
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 88.52
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 88.25
3d59_A383 Platelet-activating factor acetylhydrolase; secret 87.87
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 87.61
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 87.48
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 87.36
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 87.33
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 87.02
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 86.98
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 86.71
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 86.62
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 85.92
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 85.37
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 84.49
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 84.13
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 83.44
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 83.39
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 83.02
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 83.0
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 82.56
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 81.06
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 81.03
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 80.86
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
Probab=100.00  E-value=3.4e-84  Score=655.06  Aligned_cols=344  Identities=33%  Similarity=0.660  Sum_probs=292.3

Q ss_pred             ccccccccCCCCCCCCCcceEEeeEEeccCCCceEEEEEEecCCCCCCCCCCeEEeeCCCCChhhhhhcccccccCEEEe
Q 016137           34 QEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYWLVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVR  113 (394)
Q Consensus        34 ~~~~~v~~lpg~~~~~~~~~~sGy~~v~~~~~~~lfy~~~es~~~~~~~~~pl~lwlnGGPG~Ss~~~g~~~e~GP~~~~  113 (394)
                      ++.++|++|||++.++++++|||||+|++  +++||||||||++  +|+++||+|||||||||||+ .|+|.|+|||+++
T Consensus         2 ~~~d~V~~LPg~~~~~~~~~~sGyv~v~~--~~~lfy~f~~s~~--~~~~~Pl~lwlnGGPG~Ss~-~g~~~e~GP~~~~   76 (452)
T 1ivy_A            2 PDQDEIQRLPGLAKQPSFRQYSGYLKSSG--SKHLHYWFVESQK--DPENSPVVLWLNGGPGCSSL-DGLLTEHGPFLVQ   76 (452)
T ss_dssp             CTTTBCSSCTTCSSCCSSCEEEEEEECST--TEEEEEEEECCSS--CGGGSCEEEEECCTTTBCTH-HHHHTTTSSEEEC
T ss_pred             CccCccccCCCCCCCCCceeeEEEEeeCC--CCeEEEEEEEcCC--CCCCCCEEEEECCCCcHHHH-HHHHHhcCCcEEe
Confidence            35789999999988889999999999964  5899999999998  89999999999999999999 7999999999999


Q ss_pred             cCCCceeeCccCcccCcceeeecCCCCcccccccCCCCccccCcccchHHHHHHHHHHHHHCCCCCCCCeEEeccccccc
Q 016137          114 RDGKRLKLNPYAWNKEANILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYAGH  193 (394)
Q Consensus       114 ~~~~~l~~n~~sw~~~~n~l~iDqP~g~GfSy~~~~~~~~~~~~~~~a~~~~~fl~~f~~~fp~~~~~~~~i~GeSy~G~  193 (394)
                      .++.+++.|++||++.+||||||||+||||||... .++.. +++++|+|+++||++||++||+|++++|||+||||||+
T Consensus        77 ~~~~~l~~n~~sw~~~~~~lfiDqP~GtGfS~~~~-~~~~~-~~~~~a~~~~~~l~~f~~~~p~~~~~~~~i~GeSYgG~  154 (452)
T 1ivy_A           77 PDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDD-KFYAT-NDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGI  154 (452)
T ss_dssp             TTSSCEEECTTCGGGSSEEEEECCSTTSTTCEESS-CCCCC-BHHHHHHHHHHHHHHHHHHSGGGTTSCEEEEEETTHHH
T ss_pred             CCCceeeeCCCcccccccEEEEecCCCCCcCCcCC-CCCcC-CcHHHHHHHHHHHHHHHHhcHHhcCCCEEEEeecccee
Confidence            88888999999999999999999999999999654 34443 66789999999999999999999999999999999999


Q ss_pred             chHHHHHHHHhhcCCCCCCceeeeeeEecCCCcCccccccccccccccccCCChhHHHHHHhhCCCC---C-CCCChhHH
Q 016137          194 YIPELCQVIVRGNKGVKNPIINFKGFLLGNPLIDDYFDNIGTHEYWWNHGLISDSTYQDLKKFCPHE---T-FLFPKNEC  269 (394)
Q Consensus       194 yvp~la~~i~~~n~~~~~~~inLkGi~IGNg~~dp~~q~~s~~~fa~~~GlIs~~~~~~~~~~C~~~---~-~~~~~~~C  269 (394)
                      |||.+|.+|++.      ..+|||||+||||++||..|..++.+|+|+||+|++++++.+++.|...   . ......+|
T Consensus       155 y~p~la~~i~~~------~~~~l~g~~ign~~~d~~~~~~~~~~~~~~~glis~~~~~~~~~~c~~~~~~~~~~~~~~~C  228 (452)
T 1ivy_A          155 YIPTLAVLVMQD------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLEC  228 (452)
T ss_dssp             HHHHHHHHHTTC------TTSCEEEEEEESCCSBHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHEETTEECCSSCCCHHH
T ss_pred             ehHHHHHHHHhc------CccccceEEecCCccChhhhhhhHHHHHhhhhcCCHHHHHHHHHHhhhcccccccccchHHH
Confidence            999999999853      4799999999999999999999999999999999999999999988532   0 12334679


Q ss_pred             HHHHHHHHHh--cCCCCCCCCCCCCCCCcccccc----------ccc--CC-----CCCc---------cCCCCcccc-h
Q 016137          270 ESALSRAYSE--FADVNPYSIYSSPCFESGTLKR----------NLQ--LP-----LPWK---------FRGVDECVV-K  320 (394)
Q Consensus       270 ~~a~~~~~~~--~~~in~Y~i~~~~C~~~~~~~~----------~~~--~~-----~~~~---------~~~~~pc~~-~  320 (394)
                      ..+++.+.+.  .+++|+|+|+.+ |......+.          ...  .+     +.+.         ....+||.+ .
T Consensus       229 ~~~~~~~~~~~~~~~in~Y~i~~~-C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pc~~~~  307 (452)
T 1ivy_A          229 VTNLQEVARIVGNSGLNIYNLYAP-CAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTT  307 (452)
T ss_dssp             HHHHHHHHHHHHSSSCCTTCTTSC-CTTCCSSSEEEETTEEEECCCSCSSTTSCCCCCCGGGHHHHTCEEEECCTTCCCH
T ss_pred             HHHHHHHHHHHhcCCCcccccccc-cccccccccchhcccccccccchhhhhhhhccccccccccccccccCCCCccchH
Confidence            9999888765  488999999986 753311000          000  00     0000         011237854 5


Q ss_pred             hHHHhcChHHHHhhhcCCCCCCCccceecc---------------------------------CCCCccCCchhhHHHHH
Q 016137          321 YTKVYMNRLDVQKALHADASLINHPWGSCS---------------------------------GDTDAILPLTATRYSIG  367 (394)
Q Consensus       321 ~~~~YLN~p~VrkALhV~~~~~~~~W~~cs---------------------------------Gd~D~i~n~~Gt~~wi~  367 (394)
                      .++.|||+++||+||||+..  ..+|..||                                 ||+|++||+.||++||+
T Consensus       308 ~~~~ylN~~~Vq~ALhv~~~--~~~W~~Cs~~V~~~~~~~~~s~~~~~~~LL~~~girVlIYsGD~D~icn~~Gt~~wi~  385 (452)
T 1ivy_A          308 AASTYLNNPYVRKALNIPEQ--LPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVD  385 (452)
T ss_dssp             HHHHHHTSHHHHHHTTCCTT--SCCCCSBCHHHHHHCBCCCSBSHHHHHHHHHHTCCEEEEEEETTCSSSCHHHHHHHHH
T ss_pred             HHHHHhCcHHHHHHcCCCCC--CCccccCcHHHHhhhhcccccHHHHHHHHHhccCceEEEEeCCCCccCCcHHHHHHHH
Confidence            68999999999999999853  35799998                                 99999999999999999


Q ss_pred             hCCCCCccceeeeeeCC-C----cEeEEEEEC
Q 016137          368 SLKLETNISWYAWLDDH-F----QVSDYISSW  394 (394)
Q Consensus       368 ~L~w~~~a~~~~W~~~~-~----qvaGyv~~Y  394 (394)
                      +|+|++..+|+||++ + +    |||||+|+|
T Consensus       386 ~L~~~~~~~~~pw~~-~~~~~~~~vaG~~~~y  416 (452)
T 1ivy_A          386 SLNQKMEVQRRPWLV-KYGDSGEQIAGFVKEF  416 (452)
T ss_dssp             HTCCCEEEEEEEEEE-ECTTSCEEEEEEEEEE
T ss_pred             hcCCcccccceeeee-ccCCCCcccceEEEEE
Confidence            999999999999998 4 4    999999987
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 394
g1wht.1409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 1e-102
g1gxs.1425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 6e-99
d1ivya_452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 2e-86
d1ac5a_483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 2e-76
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 4e-65
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query394
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 100.0
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 100.0
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.41
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.18
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.8
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 97.75
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 97.73
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 97.69
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 97.54
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 97.47
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 97.43
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 97.41
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 97.29
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.28
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 97.25
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 97.24
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.22
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 97.15
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 97.11
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.0
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 96.85
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 96.79
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 96.76
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 96.72
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 96.59
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 96.55
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 96.53
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 96.41
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 96.3
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 96.28
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 96.26
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 96.12
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 96.04
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 96.03
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 95.89
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 95.78
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 94.87
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 94.3
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 94.15
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 93.98
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 93.69
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 93.26
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 92.7
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 92.65
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 92.39
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 92.33
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 92.2
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 91.78
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 91.67
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 91.21
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 91.19
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 90.79
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 90.77
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 90.01
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 89.96
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 89.54
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 88.84
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 87.34
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 84.47
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 84.19
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 84.08
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 83.95
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 81.81
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 81.42
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 81.42
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 81.2
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure