Citrus Sinensis ID: 016148
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 394 | 2.2.26 [Sep-21-2011] | |||||||
| O64511 | 399 | Protein TWIN LOV 1 OS=Ara | yes | no | 0.903 | 0.892 | 0.649 | 1e-137 | |
| P93025 | 915 | Phototropin-2 OS=Arabidop | no | no | 0.817 | 0.351 | 0.331 | 2e-48 | |
| O48963 | 996 | Phototropin-1 OS=Arabidop | no | no | 0.362 | 0.143 | 0.393 | 2e-27 | |
| Q2RBR1 | 921 | Phototropin-1B OS=Oryza s | no | no | 0.299 | 0.128 | 0.428 | 2e-27 | |
| Q2QYY8 | 921 | Phototropin-1A OS=Oryza s | no | no | 0.299 | 0.128 | 0.428 | 2e-27 | |
| Q9ST27 | 907 | Phototropin-2 OS=Oryza sa | no | no | 0.362 | 0.157 | 0.393 | 2e-27 | |
| Q8FW73 | 489 | Blue-light-activated hist | yes | no | 0.243 | 0.196 | 0.484 | 2e-24 | |
| A9WYQ7 | 489 | Blue-light-activated hist | yes | no | 0.243 | 0.196 | 0.484 | 2e-24 | |
| Q8YC53 | 489 | Blue-light-activated hist | yes | no | 0.243 | 0.196 | 0.484 | 2e-24 | |
| A9MBM8 | 489 | Blue-light-activated hist | yes | no | 0.243 | 0.196 | 0.484 | 2e-24 |
| >sp|O64511|TLOV1_ARATH Protein TWIN LOV 1 OS=Arabidopsis thaliana GN=TLP1 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 487 bits (1253), Expect = e-137, Method: Compositional matrix adjust.
Identities = 241/371 (64%), Positives = 289/371 (77%), Gaps = 15/371 (4%)
Query: 11 SFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQ 70
SF+ RYTLW+ EAL+ELP +FTITDP ISGHPIVFAS GFLKM+G+SR E+IGRNG++FQ
Sbjct: 19 SFSGRYTLWIKEALEELPHNFTITDPFISGHPIVFASLGFLKMTGYSREEVIGRNGKVFQ 78
Query: 71 GPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVAVQ 130
GP+TNRR+IMEIREAIREER ++V+LLNY+K G+PFWMLF M VFGK+DG+ T+FVAVQ
Sbjct: 79 GPKTNRRSIMEIREAIREERSVQVSLLNYRKSGSPFWMLFHMCPVFGKDDGKVTNFVAVQ 138
Query: 131 VPIVSRKH----MRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLALDSDD- 185
VPI R+H +RN G S D + FGSCRREVC + + DR L ++ DD
Sbjct: 139 VPISGREHHRKKLRNVG-DLSSDTSPT------FGSCRREVCFGNFVCQDRALPVECDDD 191
Query: 186 -TGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLY 244
GLE + CEAS+ EK KA AI+N+LS+L HYS+L+GRLVCGKR L G+ +SSSL
Sbjct: 192 EQGLEDWEQCEASESEKLKATEAINNVLSILVHYSELSGRLVCGKRYCLRGVDCLSSSLV 251
Query: 245 ISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQ 304
ISLGRIKQSFVL +P LPDMP++YASDAFL LTGY R EV+GQNCRFL+GVDTD++VLY+
Sbjct: 252 ISLGRIKQSFVLTNPCLPDMPIIYASDAFLTLTGYKRQEVLGQNCRFLSGVDTDSSVLYE 311
Query: 305 IKESIQTEQACTVRILNY--RKDKSSFWNLLHISPIRNASGKIAYFAAVHTEEGCRNQDR 362
+KE I Q+CTV+ILNY RKDKSSFWNLLHISP+RNASGK AYF V E CRN +
Sbjct: 312 MKECILKGQSCTVQILNYSNRKDKSSFWNLLHISPVRNASGKTAYFVGVQVEASCRNTEI 371
Query: 363 HGLSLEMRQLS 373
L E RQLS
Sbjct: 372 KELRPETRQLS 382
|
Arabidopsis thaliana (taxid: 3702) |
| >sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8FW73|LOVHK_BRUSU Blue-light-activated histidine kinase OS=Brucella suis biovar 1 (strain 1330) GN=BRA0588 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|A9WYQ7|LOVHK_BRUSI Blue-light-activated histidine kinase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=BSUIS_B0585 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q8YC53|LOVHK_BRUME Blue-light-activated histidine kinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEII0679 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|A9MBM8|LOVHK_BRUC2 Blue-light-activated histidine kinase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=BCAN_B0589 PE=3 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 394 | ||||||
| 224110804 | 396 | predicted protein [Populus trichocarpa] | 0.982 | 0.977 | 0.714 | 1e-165 | |
| 225424899 | 397 | PREDICTED: protein TWIN LOV 1 [Vitis vin | 0.994 | 0.987 | 0.716 | 1e-161 | |
| 224102353 | 396 | predicted protein [Populus trichocarpa] | 0.959 | 0.954 | 0.697 | 1e-159 | |
| 449434827 | 385 | PREDICTED: protein TWIN LOV 1-like [Cucu | 0.969 | 0.992 | 0.610 | 1e-140 | |
| 449530273 | 382 | PREDICTED: protein TWIN LOV 1-like [Cucu | 0.961 | 0.992 | 0.612 | 1e-140 | |
| 255558228 | 375 | twin lov protein, putative [Ricinus comm | 0.842 | 0.885 | 0.704 | 1e-139 | |
| 30678020 | 397 | protein TWIN LOV 1 [Arabidopsis thaliana | 0.903 | 0.896 | 0.653 | 1e-136 | |
| 356498170 | 388 | PREDICTED: protein TWIN LOV 1-like [Glyc | 0.964 | 0.979 | 0.612 | 1e-135 | |
| 297817884 | 386 | pac motif-containing protein [Arabidopsi | 0.908 | 0.927 | 0.652 | 1e-135 | |
| 358248936 | 390 | protein TWIN LOV 1-like [Glycine max] gi | 0.964 | 0.974 | 0.612 | 1e-135 |
| >gi|224110804|ref|XP_002315641.1| predicted protein [Populus trichocarpa] gi|222864681|gb|EEF01812.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 588 bits (1517), Expect = e-165, Method: Compositional matrix adjust.
Identities = 283/396 (71%), Positives = 332/396 (83%), Gaps = 9/396 (2%)
Query: 1 MDSQLGLIEQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAE 60
M+SQL LIE+SFN RY+ WV EAL+ELP +FTITDP+ISGHPIVFAS GFLKMSGF R +
Sbjct: 1 MESQLALIEKSFNTRYSPWVREALEELPHNFTITDPTISGHPIVFASPGFLKMSGFRRDQ 60
Query: 61 IIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKED 120
+IG NGRMFQGP+TNR+T+MEIREAIREER ++V+L NY+KDGTPFWMLF+MS VF KED
Sbjct: 61 VIGNNGRMFQGPKTNRKTVMEIREAIREERAVQVSLWNYRKDGTPFWMLFQMSPVFSKED 120
Query: 121 GRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLA 180
GR HF+ VQVPI+ K ++DG + EIVFGSCRREVCSDSL++L RVLA
Sbjct: 121 GRVIHFIGVQVPILRNKRS-------TDDGADAAWNEIVFGSCRREVCSDSLVELGRVLA 173
Query: 181 LDS--DDTGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGF 238
LD+ + G+E E+ EASDLEK++AAT I+NILSVLTHYS+ TGRL CGKRCS P G
Sbjct: 174 LDTYTNCRGVETEEPWEASDLEKQRAATTINNILSVLTHYSESTGRLACGKRCSSPAAGL 233
Query: 239 ISSSLYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTD 298
I+SSL ISLGRI QSFVLIDPHLP+MP+VYASDAFLKLTGYDR+EV+G N RFL+GV TD
Sbjct: 234 INSSLNISLGRINQSFVLIDPHLPNMPIVYASDAFLKLTGYDRHEVLGCNWRFLSGVGTD 293
Query: 299 TTVLYQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKIAYFAAVHTEEGCR 358
++VL QI+ES+Q EQACTV LNYRKDKS+FWNLLH+SP+RNA+GKIAYF V EE C+
Sbjct: 294 SSVLNQIQESMQVEQACTVCFLNYRKDKSTFWNLLHMSPVRNATGKIAYFVGVQMEEKCK 353
Query: 359 NQDRHGLSLEMRQLSAIGAIKVAVRSLSMGAGPSKS 394
+QDRHGLS E RQLSA+GA+KVAVRSLSMGAG SKS
Sbjct: 354 SQDRHGLSPETRQLSAVGAVKVAVRSLSMGAGCSKS 389
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225424899|ref|XP_002269901.1| PREDICTED: protein TWIN LOV 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224102353|ref|XP_002312647.1| predicted protein [Populus trichocarpa] gi|222852467|gb|EEE90014.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449434827|ref|XP_004135197.1| PREDICTED: protein TWIN LOV 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449530273|ref|XP_004172120.1| PREDICTED: protein TWIN LOV 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255558228|ref|XP_002520141.1| twin lov protein, putative [Ricinus communis] gi|223540633|gb|EEF42196.1| twin lov protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|30678020|ref|NP_849928.1| protein TWIN LOV 1 [Arabidopsis thaliana] gi|18146960|dbj|BAB83170.1| twin LOV protein 1 [Arabidopsis thaliana] gi|330250519|gb|AEC05613.1| protein TWIN LOV 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356498170|ref|XP_003517926.1| PREDICTED: protein TWIN LOV 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297817884|ref|XP_002876825.1| pac motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322663|gb|EFH53084.1| pac motif-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|358248936|ref|NP_001240221.1| protein TWIN LOV 1-like [Glycine max] gi|156069000|gb|ABU44493.1| PAS/LOV protein 1 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 394 | ||||||
| TAIR|locus:2058852 | 399 | PLPB "PAS/LOV PROTEIN C" [Arab | 0.954 | 0.942 | 0.610 | 2.6e-118 | |
| TAIR|locus:2155821 | 915 | PHOT2 "phototropin 2" [Arabido | 0.284 | 0.122 | 0.437 | 2.2e-43 | |
| UNIPROTKB|Q2QYY8 | 921 | PHOT1A "Phototropin-1A" [Oryza | 0.284 | 0.121 | 0.437 | 7.7e-43 | |
| UNIPROTKB|Q2RBR1 | 921 | PHOT1B "Phototropin-1B" [Oryza | 0.284 | 0.121 | 0.437 | 9.8e-43 | |
| UNIPROTKB|Q9ST27 | 907 | PHOT2 "Phototropin-2" [Oryza s | 0.362 | 0.157 | 0.393 | 1.2e-42 | |
| UNIPROTKB|Q8H935 | 963 | Vfphot1a "Phototropin" [Vicia | 0.284 | 0.116 | 0.437 | 3.9e-40 | |
| TAIR|locus:2102674 | 996 | PHOT1 "phototropin 1" [Arabido | 0.284 | 0.112 | 0.437 | 9.3e-25 | |
| UNIPROTKB|G4NFS7 | 961 | MGG_08735 "Uncharacterized pro | 0.314 | 0.129 | 0.353 | 1.9e-15 | |
| UNIPROTKB|Q887F0 | 425 | PSPTO_1346 "Sensory box/GGDEF | 0.218 | 0.202 | 0.337 | 2.8e-14 | |
| UNIPROTKB|F8WCG6 | 195 | KCNH8 "Potassium voltage-gated | 0.248 | 0.502 | 0.366 | 6.8e-13 |
| TAIR|locus:2058852 PLPB "PAS/LOV PROTEIN C" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1165 (415.2 bits), Expect = 2.6e-118, P = 2.6e-118
Identities = 234/383 (61%), Positives = 281/383 (73%)
Query: 9 EQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRM 68
E SF+ RYTLW+ EAL+ELP +FTITDP ISGHPIVFAS GFLKM+G+SR E+IGRNG++
Sbjct: 17 EDSFSGRYTLWIKEALEELPHNFTITDPFISGHPIVFASLGFLKMTGYSREEVIGRNGKV 76
Query: 69 FQGPRTNXXXXXXXXXXXXXXXXXXVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVA 128
FQGP+TN V+LLNY+K G+PFWMLF M VFGK+DG+ T+FVA
Sbjct: 77 FQGPKTNRRSIMEIREAIREERSVQVSLLNYRKSGSPFWMLFHMCPVFGKDDGKVTNFVA 136
Query: 129 VQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLAL--DSDDT 186
VQVPI R+H R + G S FGSCRREVC + + DR L + D D+
Sbjct: 137 VQVPISGREHHRKKLRNV---GDLSSDTSPTFGSCRREVCFGNFVCQDRALPVECDDDEQ 193
Query: 187 GLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYIS 246
GLE + CEAS+ EK KA AI+N+LS+L HYS+L+GRLVCGKR L G+ +SSSL IS
Sbjct: 194 GLEDWEQCEASESEKLKATEAINNVLSILVHYSELSGRLVCGKRYCLRGVDCLSSSLVIS 253
Query: 247 LGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIK 306
LGRIKQSFVL +P LPDMP++YASDAFL LTGY R EV+GQNCRFL+GVDTD++VLY++K
Sbjct: 254 LGRIKQSFVLTNPCLPDMPIIYASDAFLTLTGYKRQEVLGQNCRFLSGVDTDSSVLYEMK 313
Query: 307 ESIQTEQACTVRILNY--RKDKSSFWNLLHISPIRNASGKIAYFAAVHTEEGCRNQDRHG 364
E I Q+CTV+ILNY RKDKSSFWNLLHISP+RNASGK AYF V E CRN +
Sbjct: 314 ECILKGQSCTVQILNYSNRKDKSSFWNLLHISPVRNASGKTAYFVGVQVEASCRNTEIKE 373
Query: 365 LSLEMRQLSAIGAIKVAVRSLSM 387
L E RQLS +GA++VAVRS M
Sbjct: 374 LRPETRQLSVVGAVRVAVRSSLM 396
|
|
| TAIR|locus:2155821 PHOT2 "phototropin 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2QYY8 PHOT1A "Phototropin-1A" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2RBR1 PHOT1B "Phototropin-1B" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9ST27 PHOT2 "Phototropin-2" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8H935 Vfphot1a "Phototropin" [Vicia faba (taxid:3906)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2102674 PHOT1 "phototropin 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NFS7 MGG_08735 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q887F0 PSPTO_1346 "Sensory box/GGDEF domain protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8WCG6 KCNH8 "Potassium voltage-gated channel subfamily H member 8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| O64511 | TLOV1_ARATH | No assigned EC number | 0.6495 | 0.9035 | 0.8922 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.7.13 | LOW CONFIDENCE prediction! |
| 3rd Layer | 2.7.13.3 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00028986001 | SubName- Full=Chromosome chr1 scaffold_46, whole genome shotgun sequence; (397 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 394 | |||
| PRK13559 | 361 | PRK13559, PRK13559, hypothetical protein; Provisio | 2e-35 | |
| PRK13557 | 540 | PRK13557, PRK13557, histidine kinase; Provisional | 1e-31 | |
| PRK13558 | 665 | PRK13558, PRK13558, bacterio-opsin activator; Prov | 8e-30 | |
| PRK13558 | 665 | PRK13558, PRK13558, bacterio-opsin activator; Prov | 7e-27 | |
| PRK13557 | 540 | PRK13557, PRK13557, histidine kinase; Provisional | 8e-27 | |
| PRK13559 | 361 | PRK13559, PRK13559, hypothetical protein; Provisio | 2e-26 | |
| pfam13426 | 101 | pfam13426, PAS_9, PAS domain | 2e-21 | |
| pfam13426 | 101 | pfam13426, PAS_9, PAS domain | 2e-21 | |
| TIGR02938 | 494 | TIGR02938, nifL_nitrog, nitrogen fixation negative | 2e-08 | |
| TIGR02938 | 494 | TIGR02938, nifL_nitrog, nitrogen fixation negative | 1e-07 | |
| TIGR00229 | 124 | TIGR00229, sensory_box, PAS domain S-box | 3e-07 | |
| TIGR00229 | 124 | TIGR00229, sensory_box, PAS domain S-box | 3e-07 | |
| pfam00989 | 113 | pfam00989, PAS, PAS fold | 4e-06 | |
| cd00130 | 103 | cd00130, PAS, PAS domain; PAS motifs appear in arc | 1e-05 | |
| smart00086 | 43 | smart00086, PAC, Motif C-terminal to PAS motifs (l | 3e-05 | |
| COG2202 | 232 | COG2202, AtoS, FOG: PAS/PAC domain [Signal transdu | 3e-04 | |
| cd00130 | 103 | cd00130, PAS, PAS domain; PAS motifs appear in arc | 7e-04 | |
| pfam08447 | 90 | pfam08447, PAS_3, PAS fold | 9e-04 | |
| pfam00989 | 113 | pfam00989, PAS, PAS fold | 0.004 |
| >gnl|CDD|237427 PRK13559, PRK13559, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Score = 133 bits (335), Expect = 2e-35
Identities = 46/100 (46%), Positives = 64/100 (64%)
Query: 249 RIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKES 308
+ + + + DPH PD+P+V A+ AFL LTGY EVVG+NCRFL G TD + +I+ +
Sbjct: 51 QTRMAMCITDPHQPDLPIVLANQAFLDLTGYAAEEVVGRNCRFLQGAATDPIAVAKIRAA 110
Query: 309 IQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKIAYF 348
I E+ V +LNYRKD FWN LH+ P+ G++ YF
Sbjct: 111 IAAEREIVVELLNYRKDGEPFWNALHLGPVYGEDGRLLYF 150
|
Length = 361 |
| >gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237426 PRK13558, PRK13558, bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237426 PRK13558, PRK13558, bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237427 PRK13559, PRK13559, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222120 pfam13426, PAS_9, PAS domain | Back alignment and domain information |
|---|
| >gnl|CDD|222120 pfam13426, PAS_9, PAS domain | Back alignment and domain information |
|---|
| >gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >gnl|CDD|232884 TIGR00229, sensory_box, PAS domain S-box | Back alignment and domain information |
|---|
| >gnl|CDD|232884 TIGR00229, sensory_box, PAS domain S-box | Back alignment and domain information |
|---|
| >gnl|CDD|216228 pfam00989, PAS, PAS fold | Back alignment and domain information |
|---|
| >gnl|CDD|238075 cd00130, PAS, PAS domain; PAS motifs appear in archaea, eubacteria and eukarya | Back alignment and domain information |
|---|
| >gnl|CDD|197509 smart00086, PAC, Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) | Back alignment and domain information |
|---|
| >gnl|CDD|225112 COG2202, AtoS, FOG: PAS/PAC domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|238075 cd00130, PAS, PAS domain; PAS motifs appear in archaea, eubacteria and eukarya | Back alignment and domain information |
|---|
| >gnl|CDD|219844 pfam08447, PAS_3, PAS fold | Back alignment and domain information |
|---|
| >gnl|CDD|216228 pfam00989, PAS, PAS fold | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 394 | |||
| PRK13560 | 807 | hypothetical protein; Provisional | 99.97 | |
| PRK09776 | 1092 | putative diguanylate cyclase; Provisional | 99.97 | |
| PRK13560 | 807 | hypothetical protein; Provisional | 99.96 | |
| TIGR02040 | 442 | PpsR-CrtJ transcriptional regulator PpsR. This mod | 99.95 | |
| PRK09776 | 1092 | putative diguanylate cyclase; Provisional | 99.95 | |
| PRK11359 | 799 | cyclic-di-GMP phosphodiesterase; Provisional | 99.94 | |
| TIGR02938 | 494 | nifL_nitrog nitrogen fixation negative regulator N | 99.93 | |
| TIGR02040 | 442 | PpsR-CrtJ transcriptional regulator PpsR. This mod | 99.92 | |
| PF13426 | 104 | PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ | 99.8 | |
| PF13426 | 104 | PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ | 99.8 | |
| PF08448 | 110 | PAS_4: PAS fold; InterPro: IPR013656 The PAS fold | 99.75 | |
| PF00989 | 113 | PAS: PAS fold; InterPro: IPR013767 PAS domains are | 99.75 | |
| PF08448 | 110 | PAS_4: PAS fold; InterPro: IPR013656 The PAS fold | 99.74 | |
| PF00989 | 113 | PAS: PAS fold; InterPro: IPR013767 PAS domains are | 99.7 | |
| PRK13559 | 361 | hypothetical protein; Provisional | 99.65 | |
| PRK13557 | 540 | histidine kinase; Provisional | 99.63 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 99.61 | |
| PRK13559 | 361 | hypothetical protein; Provisional | 99.6 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 99.58 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 99.56 | |
| PRK13557 | 540 | histidine kinase; Provisional | 99.56 | |
| TIGR02938 | 494 | nifL_nitrog nitrogen fixation negative regulator N | 99.56 | |
| PRK10060 | 663 | RNase II stability modulator; Provisional | 99.55 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 99.49 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 99.47 | |
| PF08447 | 91 | PAS_3: PAS fold; InterPro: IPR013655 The PAS fold | 99.47 | |
| PF08447 | 91 | PAS_3: PAS fold; InterPro: IPR013655 The PAS fold | 99.45 | |
| TIGR00229 | 124 | sensory_box PAS domain S-box. The PAS domain was p | 99.41 | |
| PRK10060 | 663 | RNase II stability modulator; Provisional | 99.38 | |
| KOG3558 | 768 | consensus Hypoxia-inducible factor 1/Neuronal PAS | 99.34 | |
| TIGR00229 | 124 | sensory_box PAS domain S-box. The PAS domain was p | 99.32 | |
| PRK11359 | 799 | cyclic-di-GMP phosphodiesterase; Provisional | 99.26 | |
| PF13596 | 106 | PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. | 99.21 | |
| cd00130 | 103 | PAS PAS domain; PAS motifs appear in archaea, euba | 99.19 | |
| cd00130 | 103 | PAS PAS domain; PAS motifs appear in archaea, euba | 99.15 | |
| PF12860 | 115 | PAS_7: PAS fold | 99.15 | |
| PRK11360 | 607 | sensory histidine kinase AtoS; Provisional | 99.14 | |
| PF12860 | 115 | PAS_7: PAS fold | 99.13 | |
| PRK11073 | 348 | glnL nitrogen regulation protein NR(II); Provision | 99.13 | |
| PF13596 | 106 | PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. | 99.09 | |
| PF14598 | 111 | PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W | 99.09 | |
| TIGR02966 | 333 | phoR_proteo phosphate regulon sensor kinase PhoR. | 99.07 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 99.07 | |
| PF14598 | 111 | PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W | 99.04 | |
| TIGR02966 | 333 | phoR_proteo phosphate regulon sensor kinase PhoR. | 99.04 | |
| PRK11073 | 348 | glnL nitrogen regulation protein NR(II); Provision | 99.02 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 98.99 | |
| PRK11360 | 607 | sensory histidine kinase AtoS; Provisional | 98.94 | |
| PRK11086 | 542 | sensory histidine kinase DcuS; Provisional | 98.83 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 98.81 | |
| COG5002 | 459 | VicK Signal transduction histidine kinase [Signal | 98.79 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 98.78 | |
| COG2202 | 232 | AtoS FOG: PAS/PAC domain [Signal transduction mech | 98.77 | |
| PRK15053 | 545 | dpiB sensor histidine kinase DpiB; Provisional | 98.74 | |
| COG5002 | 459 | VicK Signal transduction histidine kinase [Signal | 98.72 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 98.69 | |
| KOG3559 | 598 | consensus Transcriptional regulator SIM1 [Transcri | 98.54 | |
| PRK11006 | 430 | phoR phosphate regulon sensor protein; Provisional | 98.54 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 98.53 | |
| PRK11006 | 430 | phoR phosphate regulon sensor protein; Provisional | 98.53 | |
| COG3290 | 537 | CitA Signal transduction histidine kinase regulati | 98.52 | |
| PF13188 | 64 | PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. | 98.5 | |
| COG2202 | 232 | AtoS FOG: PAS/PAC domain [Signal transduction mech | 98.36 | |
| KOG3560 | 712 | consensus Aryl-hydrocarbon receptor [Transcription | 98.34 | |
| PF08670 | 148 | MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEK | 98.32 | |
| PRK11086 | 542 | sensory histidine kinase DcuS; Provisional | 98.32 | |
| KOG1229 | 775 | consensus 3'5'-cyclic nucleotide phosphodiesterase | 98.26 | |
| KOG3558 | 768 | consensus Hypoxia-inducible factor 1/Neuronal PAS | 98.16 | |
| KOG1229 | 775 | consensus 3'5'-cyclic nucleotide phosphodiesterase | 98.09 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 98.09 | |
| PF13188 | 64 | PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. | 98.08 | |
| COG5000 | 712 | NtrY Signal transduction histidine kinase involved | 98.06 | |
| PF08670 | 148 | MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEK | 97.97 | |
| PRK15053 | 545 | dpiB sensor histidine kinase DpiB; Provisional | 97.97 | |
| COG3290 | 537 | CitA Signal transduction histidine kinase regulati | 97.93 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 97.89 | |
| COG5000 | 712 | NtrY Signal transduction histidine kinase involved | 97.87 | |
| COG3852 | 363 | NtrB Signal transduction histidine kinase, nitroge | 97.8 | |
| COG2461 | 409 | Uncharacterized conserved protein [Function unknow | 97.74 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 97.69 | |
| smart00091 | 67 | PAS PAS domain. PAS motifs appear in archaea, euba | 97.62 | |
| COG3852 | 363 | NtrB Signal transduction histidine kinase, nitroge | 97.59 | |
| TIGR02373 | 124 | photo_yellow photoactive yellow protein. Members o | 97.54 | |
| COG2461 | 409 | Uncharacterized conserved protein [Function unknow | 97.49 | |
| KOG3753 | 1114 | consensus Circadian clock protein period [Signal t | 97.46 | |
| smart00091 | 67 | PAS PAS domain. PAS motifs appear in archaea, euba | 97.35 | |
| TIGR02373 | 124 | photo_yellow photoactive yellow protein. Members o | 97.21 | |
| COG3283 | 511 | TyrR Transcriptional regulator of aromatic amino a | 97.04 | |
| smart00086 | 43 | PAC Motif C-terminal to PAS motifs (likely to cont | 96.93 | |
| smart00086 | 43 | PAC Motif C-terminal to PAS motifs (likely to cont | 96.83 | |
| PRK10841 | 924 | hybrid sensory kinase in two-component regulatory | 96.81 | |
| COG3283 | 511 | TyrR Transcriptional regulator of aromatic amino a | 96.63 | |
| KOG3560 | 712 | consensus Aryl-hydrocarbon receptor [Transcription | 96.57 | |
| PF07310 | 137 | PAS_5: PAS domain; InterPro: IPR009922 This family | 96.25 | |
| PF07310 | 137 | PAS_5: PAS domain; InterPro: IPR009922 This family | 95.93 | |
| KOG3559 | 598 | consensus Transcriptional regulator SIM1 [Transcri | 95.47 | |
| PRK10618 | 894 | phosphotransfer intermediate protein in two-compon | 95.34 | |
| PF08348 | 118 | PAS_6: YheO-like PAS domain; InterPro: IPR013559 T | 95.21 | |
| KOG3561 | 803 | consensus Aryl-hydrocarbon receptor nuclear transl | 95.04 | |
| KOG3561 | 803 | consensus Aryl-hydrocarbon receptor nuclear transl | 94.85 | |
| PRK10841 | 924 | hybrid sensory kinase in two-component regulatory | 93.54 | |
| PF08348 | 118 | PAS_6: YheO-like PAS domain; InterPro: IPR013559 T | 92.9 | |
| COG3284 | 606 | AcoR Transcriptional activator of acetoin/glycerol | 92.9 | |
| PF08446 | 110 | PAS_2: PAS fold; InterPro: IPR013654 The PAS fold | 91.96 | |
| PF08446 | 110 | PAS_2: PAS fold; InterPro: IPR013654 The PAS fold | 90.92 | |
| KOG3753 | 1114 | consensus Circadian clock protein period [Signal t | 90.77 | |
| COG3887 | 655 | Predicted signaling protein consisting of a modifi | 90.4 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 89.12 | |
| PRK10618 | 894 | phosphotransfer intermediate protein in two-compon | 88.86 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 87.57 | |
| PRK14538 | 838 | putative bifunctional signaling protein/50S riboso | 84.8 | |
| PF09308 | 238 | LuxQ-periplasm: LuxQ, periplasmic; InterPro: IPR01 | 82.53 | |
| PRK13719 | 217 | conjugal transfer transcriptional regulator TraJ; | 80.1 |
| >PRK13560 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=99.97 E-value=2.6e-28 Score=243.52 Aligned_cols=260 Identities=15% Similarity=0.135 Sum_probs=203.5
Q ss_pred HHHHHHHHHHhhCCCeEEEEcCCCCCCcEEEechhhHHhcCCCcchhcCCCCccccCCCCChhHHHHHHHHHHhCCCeeE
Q 016148 15 RYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIREAIREERPIEV 94 (394)
Q Consensus 15 r~~~~l~~l~~~~~~~i~~~d~~~~d~~i~~~N~a~~~~~G~~~~e~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 94 (394)
++.++|+.+++++|++++++|.+ |+|+++|+++++++||++++++|+++..+.++.............+..+....+
T Consensus 201 ~~~~~l~~l~e~~~~~i~~~d~~---g~i~~~N~~~~~~~G~~~~e~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 277 (807)
T PRK13560 201 EALHFLQQLLDNIADPAFWKDED---AKVFGCNDAACLACGFRREEIIGMSIHDFAPAQPADDYQEADAAKFDADGSQII 277 (807)
T ss_pred HHHHHHHHHHhhCCCeEEEEcCC---CCEEEEhHHHHHHhCCCHHHHcCCcchhcCCcchhHHHHHHHHHHhccCCceEE
Confidence 46678999999999999999999 999999999999999999999999988887665544443444555666667778
Q ss_pred EEeeEecCCCeEEEEEEE--EeeeccCCCeeeEEEEEecccccccccccccCcccccCCCCchhHHHhhhhhhhhhhhhh
Q 016148 95 NLLNYKKDGTPFWMLFKM--SLVFGKEDGRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSL 172 (394)
Q Consensus 95 e~~~~~~dG~~~~v~~~~--~~i~~~~~g~~~~~~~~~~DITe~k~~e~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~ 172 (394)
+..+.++||..+|+.+.. .|+.+ .+|.+.|++++++|||++|++
T Consensus 278 e~~~~~~dG~~~~~~~~~~~~~~~~-~~g~~~g~~~~~~DITerk~~--------------------------------- 323 (807)
T PRK13560 278 EAEFQNKDGRTRPVDVIFNHAEFDD-KENHCAGLVGAITDISGRRAA--------------------------------- 323 (807)
T ss_pred EEEEEcCCCCEEEEEEEecceEEEc-CCCCEEEEEEEEEechHHHHH---------------------------------
Confidence 888999999999776554 55677 899999999999999999996
Q ss_pred hhhhhhcccCCCCCCCccccchhhhHHHHHHhHhhhhhHHHhhhhccccccceeeccccCCcchhhhHHHHHHHHhcccc
Q 016148 173 LDLDRVLALDSDDTGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQ 252 (394)
Q Consensus 173 ~e~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 252 (394)
+..++.. ...++.+++++++
T Consensus 324 -------------------------e~~L~~s-----------------------------------e~~l~~l~~~~~~ 343 (807)
T PRK13560 324 -------------------------ERELLEK-----------------------------------EDMLRAIIEAAPI 343 (807)
T ss_pred -------------------------HHHHHHH-----------------------------------HHHHHHHHHhCcc
Confidence 1112111 1235567889999
Q ss_pred eEEEEcCCCCCcCEEEe-CHHHHHHhcCCchhhcCCcccccccCC---------------CchhHH--HHHHHHHhccCe
Q 016148 253 SFVLIDPHLPDMPMVYA-SDAFLKLTGYDRNEVVGQNCRFLNGVD---------------TDTTVL--YQIKESIQTEQA 314 (394)
Q Consensus 253 ~i~~~d~~~~dg~i~~~-N~~~~~~~G~~~~e~~g~~~~~l~~~~---------------~~~~~~--~~~~~~~~~~~~ 314 (394)
+++++|. +|.++++ |+++++++||+.++++|+++..+.+.. ..+... ..+...+..+..
T Consensus 344 ~i~~~d~---~g~i~~~nn~~~~~~~G~~~~e~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 420 (807)
T PRK13560 344 AAIGLDA---DGNICFVNNNAAERMLGWSAAEVMGKPLPGMDPELNEEFWCGDFQEWYPDGRPMAFDACPMAKTIKGGKI 420 (807)
T ss_pred cEEEEcC---CCCEEEecCHHHHHHhCCCHHHHcCCCccccChhhhhhhhhchhhhcCCcCCcchhhhhhHHHHHhcCCc
Confidence 9999999 7999987 577888999999999998865443211 111111 112233455555
Q ss_pred ee-EEEEEEecCCCeeEEEEEeeeeecCCCCEEEEEEEEeecchhhhhhHHHHHHHHHHHH
Q 016148 315 CT-VRILNYRKDKSSFWNLLHISPIRNASGKIAYFAAVHTEEGCRNQDRHGLSLEMRQLSA 374 (394)
Q Consensus 315 ~~-~e~~~~~~~G~~~~~~~~~~~i~d~~g~~~~~~~~~~DIT~~k~~e~~L~~~~~~l~~ 374 (394)
+. .+++..+++|..+|+.....|+.+.+|.+.+++++++|||++|++|++|++++..++.
T Consensus 421 ~~~~e~~~~~~~g~~~~~~~~~~p~~d~~g~~~~~~~~~~DITerk~~E~~L~~~~~~~e~ 481 (807)
T PRK13560 421 FDGQEVLIEREDDGPADCSAYAEPLHDADGNIIGAIALLVDITERKQVEEQLLLANLIVEN 481 (807)
T ss_pred ccCceEEEEcCCCCeEEEEEEEeeeECCCCCEEEEEEEeehhhhHHHHHHHHHHHHHHHhc
Confidence 43 4777888999999999999999999999999999999999999999999987655543
|
|
| >PRK09776 putative diguanylate cyclase; Provisional | Back alignment and domain information |
|---|
| >PRK13560 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02040 PpsR-CrtJ transcriptional regulator PpsR | Back alignment and domain information |
|---|
| >PRK09776 putative diguanylate cyclase; Provisional | Back alignment and domain information |
|---|
| >PRK11359 cyclic-di-GMP phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >TIGR02040 PpsR-CrtJ transcriptional regulator PpsR | Back alignment and domain information |
|---|
| >PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A | Back alignment and domain information |
|---|
| >PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A | Back alignment and domain information |
|---|
| >PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] | Back alignment and domain information |
|---|
| >PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] | Back alignment and domain information |
|---|
| >PRK13559 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >PRK13559 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL | Back alignment and domain information |
|---|
| >PRK10060 RNase II stability modulator; Provisional | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >TIGR00229 sensory_box PAS domain S-box | Back alignment and domain information |
|---|
| >PRK10060 RNase II stability modulator; Provisional | Back alignment and domain information |
|---|
| >KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] | Back alignment and domain information |
|---|
| >TIGR00229 sensory_box PAS domain S-box | Back alignment and domain information |
|---|
| >PRK11359 cyclic-di-GMP phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D | Back alignment and domain information |
|---|
| >cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya | Back alignment and domain information |
|---|
| >cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya | Back alignment and domain information |
|---|
| >PF12860 PAS_7: PAS fold | Back alignment and domain information |
|---|
| >PRK11360 sensory histidine kinase AtoS; Provisional | Back alignment and domain information |
|---|
| >PF12860 PAS_7: PAS fold | Back alignment and domain information |
|---|
| >PRK11073 glnL nitrogen regulation protein NR(II); Provisional | Back alignment and domain information |
|---|
| >PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D | Back alignment and domain information |
|---|
| >PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A | Back alignment and domain information |
|---|
| >TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A | Back alignment and domain information |
|---|
| >TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR | Back alignment and domain information |
|---|
| >PRK11073 glnL nitrogen regulation protein NR(II); Provisional | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11360 sensory histidine kinase AtoS; Provisional | Back alignment and domain information |
|---|
| >PRK11086 sensory histidine kinase DcuS; Provisional | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15053 dpiB sensor histidine kinase DpiB; Provisional | Back alignment and domain information |
|---|
| >COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >KOG3559 consensus Transcriptional regulator SIM1 [Transcription] | Back alignment and domain information |
|---|
| >PRK11006 phoR phosphate regulon sensor protein; Provisional | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK11006 phoR phosphate regulon sensor protein; Provisional | Back alignment and domain information |
|---|
| >COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A | Back alignment and domain information |
|---|
| >COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] | Back alignment and domain information |
|---|
| >PF08670 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEKHLA domain shares similarity with the PAS domain and is found in the 3' end of plant HD-ZIP III homeobox genes, and bacterial proteins | Back alignment and domain information |
|---|
| >PRK11086 sensory histidine kinase DcuS; Provisional | Back alignment and domain information |
|---|
| >KOG1229 consensus 3'5'-cyclic nucleotide phosphodiesterases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] | Back alignment and domain information |
|---|
| >KOG1229 consensus 3'5'-cyclic nucleotide phosphodiesterases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A | Back alignment and domain information |
|---|
| >COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08670 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEKHLA domain shares similarity with the PAS domain and is found in the 3' end of plant HD-ZIP III homeobox genes, and bacterial proteins | Back alignment and domain information |
|---|
| >PRK15053 dpiB sensor histidine kinase DpiB; Provisional | Back alignment and domain information |
|---|
| >COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2461 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >smart00091 PAS PAS domain | Back alignment and domain information |
|---|
| >COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02373 photo_yellow photoactive yellow protein | Back alignment and domain information |
|---|
| >COG2461 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3753 consensus Circadian clock protein period [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00091 PAS PAS domain | Back alignment and domain information |
|---|
| >TIGR02373 photo_yellow photoactive yellow protein | Back alignment and domain information |
|---|
| >COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) | Back alignment and domain information |
|---|
| >smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) | Back alignment and domain information |
|---|
| >PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] | Back alignment and domain information |
|---|
| >PF07310 PAS_5: PAS domain; InterPro: IPR009922 This family contains a number of hypothetical bacterial proteins of unknown function approximately 200 residues long | Back alignment and domain information |
|---|
| >PF07310 PAS_5: PAS domain; InterPro: IPR009922 This family contains a number of hypothetical bacterial proteins of unknown function approximately 200 residues long | Back alignment and domain information |
|---|
| >KOG3559 consensus Transcriptional regulator SIM1 [Transcription] | Back alignment and domain information |
|---|
| >PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >PF08348 PAS_6: YheO-like PAS domain; InterPro: IPR013559 This domain is found in various hypothetical bacterial proteins that are similar to the Escherichia coli protein YheO (P64624 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] | Back alignment and domain information |
|---|
| >KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] | Back alignment and domain information |
|---|
| >PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >PF08348 PAS_6: YheO-like PAS domain; InterPro: IPR013559 This domain is found in various hypothetical bacterial proteins that are similar to the Escherichia coli protein YheO (P64624 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] | Back alignment and domain information |
|---|
| >PF08446 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >PF08446 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] | Back alignment and domain information |
|---|
| >KOG3753 consensus Circadian clock protein period [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3887 Predicted signaling protein consisting of a modified GGDEF domain and a DHH domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PRK14538 putative bifunctional signaling protein/50S ribosomal protein L9; Provisional | Back alignment and domain information |
|---|
| >PF09308 LuxQ-periplasm: LuxQ, periplasmic; InterPro: IPR015387 This entry represents the periplasmic sensor domain of the prokaryotic protein LuxQ, that assumes a structure consisting of two tandem Per/ARNT/Simple-minded (PAS) folds [] | Back alignment and domain information |
|---|
| >PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 394 | ||||
| 2wkp_A | 332 | Structure Of A Photoactivatable Rac1 Containing Lov | 7e-29 | ||
| 2v0u_A | 146 | N- And C-terminal Helices Of Oat Lov2 (404-546) Are | 2e-28 | ||
| 2v1a_A | 144 | N- And C-Terminal Helices Of Oat Lov2 (404-546) Are | 2e-28 | ||
| 2wkq_A | 332 | Structure Of A Photoactivatable Rac1 Containing The | 9e-28 | ||
| 2wkr_A | 332 | Structure Of A Photoactivatable Rac1 Containing The | 1e-27 | ||
| 1n9l_A | 109 | Crystal Structure Of The Phot-lov1 Domain From Chla | 4e-27 | ||
| 4eep_A | 115 | Crystal Structure Of Lov2 Domain Of Arabidopsis Tha | 1e-26 | ||
| 4eeu_A | 118 | Crystal Structure Of Philov2.1 Length = 118 | 2e-26 | ||
| 4ees_A | 115 | Crystal Structure Of Ilov Length = 115 | 2e-26 | ||
| 2z6c_A | 129 | Crystal Structure Of Lov1 Domain Of Phototropin1 Fr | 1e-25 | ||
| 4eer_A | 115 | Crystal Structure Of Lov2 Domain Of Arabidopsis Tha | 2e-25 | ||
| 3t50_A | 128 | X-Ray Structure Of The Lov Domain From The Lov-Hk S | 2e-25 | ||
| 1g28_A | 104 | Structure Of A Flavin-Binding Domain, Lov2, From Th | 6e-25 | ||
| 2z6d_A | 130 | Crystal Structure Of Lov1 Domain Of Phototropin2 Fr | 2e-23 | ||
| 3ue6_A | 166 | The Dark Structure Of The Blue-light Photoreceptor | 5e-22 | ||
| 3ulf_A | 170 | The Light State Structure Of The Blue-light Photore | 5e-22 | ||
| 2pr5_A | 132 | Structural Basis For Light-dependent Signaling In T | 5e-19 | ||
| 3p7n_A | 258 | Crystal Structure Of Light Activated Transcription | 6e-16 | ||
| 3sw1_A | 162 | Structure Of A Full-Length Bacterial Lov Protein Le | 1e-14 | ||
| 3rh8_B | 148 | Crystal Structure Of The Light-State Dimer Of Funga | 4e-14 | ||
| 3hjk_A | 154 | 2.0 Angstrom Structure Of The Ile74val Variant Of V | 1e-13 | ||
| 3hji_A | 154 | 1.8 Angstrom Crystal Structure Of The I74v:i85v Var | 1e-13 | ||
| 3d72_A | 149 | 1.65 Angstrom Crystal Structure Of The Cys71val Var | 2e-13 | ||
| 3is2_A | 154 | 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic | 2e-13 | ||
| 3is2_B | 154 | 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic | 2e-13 | ||
| 2pd8_A | 149 | 1.8 Angstrom Crystal Structure Of The Cys71ser Muta | 2e-13 | ||
| 2pd7_A | 149 | 2.0 Angstrom Crystal Structure Of The Fungal Blue-L | 2e-13 | ||
| 4hj4_A | 177 | Crystal Structure Of Rhodobacter Sphaeroides Lov Pr | 2e-12 | ||
| 4hj6_A | 178 | Crystal Structure Of Rhodobacter Sphaeroides Lov Pr | 2e-12 | ||
| 4hj3_A | 176 | Crystal Structure Of Rhodobacter Sphaeroides Lov Pr | 2e-12 | ||
| 4hia_A | 176 | Crystal Structure Of Rhodobacter Sphaeroides Lov Pr | 3e-12 | ||
| 2l0w_A | 138 | Solution Nmr Structure Of The N-Terminal Pas Domain | 9e-08 | ||
| 2l4r_A | 135 | Nmr Solution Structure Of The N-Terminal Pas Domain | 1e-07 | ||
| 2l1m_A | 150 | Solution Structure Of The Eag Domain Of The Herg (K | 2e-07 | ||
| 1byw_A | 110 | Structure Of The N-Terminal Domain Of The Human-Erg | 8e-07 | ||
| 2gj3_A | 120 | Crystal Structure Of The Fad-Containing Pas Domain | 4e-06 | ||
| 3ewk_A | 227 | Structure Of The Redox Sensor Domain Of Methylococc | 1e-04 |
| >pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 | Back alignment and structure |
|
| >pdb|2V0U|A Chain A, N- And C-terminal Helices Of Oat Lov2 (404-546) Are Involved In Light-induced Signal Transduction (cryo Dark Structure Of Lov2 (404-546)) Length = 146 | Back alignment and structure |
| >pdb|2V1A|A Chain A, N- And C-Terminal Helices Of Oat Lov2 (404-546) Are Involved In Light-Induced Signal Transduction (Room Temperature (293k) Dark Structure Of Lov2 (404-546)) Length = 144 | Back alignment and structure |
| >pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 | Back alignment and structure |
| >pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 | Back alignment and structure |
| >pdb|1N9L|A Chain A, Crystal Structure Of The Phot-lov1 Domain From Chlamydomonas Reinhardtii In The Dark State. Length = 109 | Back alignment and structure |
| >pdb|4EEP|A Chain A, Crystal Structure Of Lov2 Domain Of Arabidopsis Thaliana Phototropin 2 Length = 115 | Back alignment and structure |
| >pdb|4EEU|A Chain A, Crystal Structure Of Philov2.1 Length = 118 | Back alignment and structure |
| >pdb|4EES|A Chain A, Crystal Structure Of Ilov Length = 115 | Back alignment and structure |
| >pdb|2Z6C|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin1 From Arabidopsis Thaliana Length = 129 | Back alignment and structure |
| >pdb|4EER|A Chain A, Crystal Structure Of Lov2 Domain Of Arabidopsis Thaliana Phototropin 2 C426a Mutant Length = 115 | Back alignment and structure |
| >pdb|3T50|A Chain A, X-Ray Structure Of The Lov Domain From The Lov-Hk Sensory Protein From Brucella Abortus (Dark State). Length = 128 | Back alignment and structure |
| >pdb|1G28|A Chain A, Structure Of A Flavin-Binding Domain, Lov2, From The Chimeric PhytochromePHOTOTROPIN PHOTORECEPTOR PHY3 Length = 104 | Back alignment and structure |
| >pdb|2Z6D|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin2 From Arabidopsis Thaliana Length = 130 | Back alignment and structure |
| >pdb|3UE6|A Chain A, The Dark Structure Of The Blue-light Photoreceptor Aureochrome1 Lov Length = 166 | Back alignment and structure |
| >pdb|3ULF|A Chain A, The Light State Structure Of The Blue-light Photoreceptor Aureochrome1 Lov Length = 170 | Back alignment and structure |
| >pdb|2PR5|A Chain A, Structural Basis For Light-dependent Signaling In The Dimeric Lov Photosensor Ytva (dark Structure) Length = 132 | Back alignment and structure |
| >pdb|3P7N|A Chain A, Crystal Structure Of Light Activated Transcription Factor El222 From Erythrobacter Litoralis Length = 258 | Back alignment and structure |
| >pdb|3SW1|A Chain A, Structure Of A Full-Length Bacterial Lov Protein Length = 162 | Back alignment and structure |
| >pdb|3RH8|B Chain B, Crystal Structure Of The Light-State Dimer Of Fungal Blue-Light Photoreceptor Vivid Length = 148 | Back alignment and structure |
| >pdb|3HJK|A Chain A, 2.0 Angstrom Structure Of The Ile74val Variant Of Vivid (Vvd). Length = 154 | Back alignment and structure |
| >pdb|3HJI|A Chain A, 1.8 Angstrom Crystal Structure Of The I74v:i85v Variant Of Vivid (Vvd). Length = 154 | Back alignment and structure |
| >pdb|3D72|A Chain A, 1.65 Angstrom Crystal Structure Of The Cys71val Variant In The Fungal Photoreceptor Vvd Length = 149 | Back alignment and structure |
| >pdb|3IS2|A Chain A, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 | Back alignment and structure |
| >pdb|3IS2|B Chain B, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 | Back alignment and structure |
| >pdb|2PD8|A Chain A, 1.8 Angstrom Crystal Structure Of The Cys71ser Mutant Of Vivid Length = 149 | Back alignment and structure |
| >pdb|2PD7|A Chain A, 2.0 Angstrom Crystal Structure Of The Fungal Blue-Light Photoreceptor Vivid Length = 149 | Back alignment and structure |
| >pdb|4HJ4|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 177 | Back alignment and structure |
| >pdb|4HJ6|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 178 | Back alignment and structure |
| >pdb|4HJ3|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 176 | Back alignment and structure |
| >pdb|4HIA|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 176 | Back alignment and structure |
| >pdb|2L0W|A Chain A, Solution Nmr Structure Of The N-Terminal Pas Domain Of Herg Potassium Channel Length = 138 | Back alignment and structure |
| >pdb|2L4R|A Chain A, Nmr Solution Structure Of The N-Terminal Pas Domain Of Herg Length = 135 | Back alignment and structure |
| >pdb|2L1M|A Chain A, Solution Structure Of The Eag Domain Of The Herg (Kv11.1) K+ Channel Length = 150 | Back alignment and structure |
| >pdb|1BYW|A Chain A, Structure Of The N-Terminal Domain Of The Human-Erg Potassium Channel Length = 110 | Back alignment and structure |
| >pdb|2GJ3|A Chain A, Crystal Structure Of The Fad-Containing Pas Domain Of The Protein Nifl From Azotobacter Vinelandii. Length = 120 | Back alignment and structure |
| >pdb|3EWK|A Chain A, Structure Of The Redox Sensor Domain Of Methylococcus Capsulatus (Bath) Mmos Length = 227 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 | Back alignment and structure |
|---|
Score = 166 bits (423), Expect = 7e-51
Identities = 54/143 (37%), Positives = 84/143 (58%)
Query: 243 LYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVL 302
L +L RI+++FV+ DP LPD P+++ASD+FL+LT Y R E++G+NCRFL G +TD +
Sbjct: 4 LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATV 63
Query: 303 YQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKIAYFAAVHTEEGCRNQDR 362
+I+++I + TV+++NY K FWNL H+ P+R+ G + YF V + +D
Sbjct: 64 RKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDA 123
Query: 363 HGLSLEMRQLSAIGAIKVAVRSL 385
M I A + L
Sbjct: 124 AEREGVMLIKKTAENIDEAAKEL 146
|
| >2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 | Back alignment and structure |
|---|
| >1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 | Back alignment and structure |
|---|
| >1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 | Back alignment and structure |
|---|
| >4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 | Back alignment and structure |
|---|
| >4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 | Back alignment and structure |
|---|
| >2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 | Back alignment and structure |
|---|
| >2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 | Back alignment and structure |
|---|
| >3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 | Back alignment and structure |
|---|
| >3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 | Back alignment and structure |
|---|
| >3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 | Back alignment and structure |
|---|
| >3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 | Back alignment and structure |
|---|
| >1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 | Back alignment and structure |
|---|
| >1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 | Back alignment and structure |
|---|
| >2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 | Back alignment and structure |
|---|
| >2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 | Back alignment and structure |
|---|
| >3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 | Back alignment and structure |
|---|
| >3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 | Back alignment and structure |
|---|
| >2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 | Back alignment and structure |
|---|
| >2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 | Back alignment and structure |
|---|
| >3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 | Back alignment and structure |
|---|
| >3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 | Back alignment and structure |
|---|
| >3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 | Back alignment and structure |
|---|
| >3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 | Back alignment and structure |
|---|
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 | Back alignment and structure |
|---|
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 | Back alignment and structure |
|---|
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 | Back alignment and structure |
|---|
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 | Back alignment and structure |
|---|
| >3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Length = 124 | Back alignment and structure |
|---|
| >3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Length = 124 | Back alignment and structure |
|---|
| >2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Length = 120 | Back alignment and structure |
|---|
| >2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Length = 120 | Back alignment and structure |
|---|
| >3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Length = 120 | Back alignment and structure |
|---|
| >3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Length = 120 | Back alignment and structure |
|---|
| >3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Length = 126 | Back alignment and structure |
|---|
| >3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Length = 126 | Back alignment and structure |
|---|
| >3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Length = 126 | Back alignment and structure |
|---|
| >2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Length = 117 | Back alignment and structure |
|---|
| >3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Length = 115 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Length = 118 | Back alignment and structure |
|---|
| >3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Length = 118 | Back alignment and structure |
|---|
| >3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Length = 125 | Back alignment and structure |
|---|
| >3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Length = 129 | Back alignment and structure |
|---|
| >3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Length = 114 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 394 | |||
| 3ewk_A | 227 | Sensor protein; PAS domain, alpha/beta fold, kinas | 100.0 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 99.94 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 99.92 | |
| 2pr5_A | 132 | Blue-light photoreceptor; light-oxygen-voltage, LO | 99.89 | |
| 3mr0_A | 142 | Sensory box histidine kinase/response regulator; P | 99.88 | |
| 3rty_A | 339 | Period circadian protein; PAS domain, signalling, | 99.88 | |
| 2gj3_A | 120 | Nitrogen fixation regulatory protein; PAS domain, | 99.87 | |
| 2gj3_A | 120 | Nitrogen fixation regulatory protein; PAS domain, | 99.86 | |
| 3f1p_B | 121 | ARYL hydrocarbon receptor nuclear translocator; PA | 99.85 | |
| 4hia_A | 176 | LOV protein; PAS, HTH, signaling protein; HET: FMN | 99.84 | |
| 1n9l_A | 109 | PHOT-LOV1, putative blue light receptor; phototrop | 99.84 | |
| 1n9l_A | 109 | PHOT-LOV1, putative blue light receptor; phototrop | 99.84 | |
| 3p7n_A | 258 | Sensor histidine kinase; LOV domain, light-activat | 99.84 | |
| 4hia_A | 176 | LOV protein; PAS, HTH, signaling protein; HET: FMN | 99.84 | |
| 3f1p_B | 121 | ARYL hydrocarbon receptor nuclear translocator; PA | 99.83 | |
| 4dj3_A | 317 | Period circadian protein homolog 3; PAS domain, ci | 99.83 | |
| 3t50_A | 128 | Blue-light-activated histidine kinase; PAS superfa | 99.83 | |
| 2pr5_A | 132 | Blue-light photoreceptor; light-oxygen-voltage, LO | 99.83 | |
| 3f1p_A | 117 | Endothelial PAS domain-containing protein 1; PAS d | 99.82 | |
| 3f1p_A | 117 | Endothelial PAS domain-containing protein 1; PAS d | 99.82 | |
| 3mr0_A | 142 | Sensory box histidine kinase/response regulator; P | 99.82 | |
| 3ue6_A | 166 | Aureochrome1; PAS/LOV domain, FMN-binding blue-lig | 99.81 | |
| 3p7n_A | 258 | Sensor histidine kinase; LOV domain, light-activat | 99.81 | |
| 3sw1_A | 162 | Sensory box protein; light-oxygen-voltage, LOV, PA | 99.8 | |
| 3ue6_A | 166 | Aureochrome1; PAS/LOV domain, FMN-binding blue-lig | 99.8 | |
| 3nja_A | 125 | Probable ggdef family protein; structural genomics | 99.79 | |
| 3t50_A | 128 | Blue-light-activated histidine kinase; PAS superfa | 99.79 | |
| 4eet_B | 115 | Phototropin-2; LOV, blue light photoreceptor, sign | 99.79 | |
| 3k3c_A | 158 | Protein RV1364C/MT1410; sensor, PAS, signal transd | 99.78 | |
| 3ewk_A | 227 | Sensor protein; PAS domain, alpha/beta fold, kinas | 99.78 | |
| 3h9w_A | 115 | Diguanylate cyclase with PAS/PAC sensor; alpha-bet | 99.78 | |
| 3gdi_A | 309 | Period circadian protein homolog 2; tandem PAS dom | 99.78 | |
| 3mqq_A | 120 | Transcriptional regulator, LUXR family; PAS domain | 99.78 | |
| 4eet_B | 115 | Phototropin-2; LOV, blue light photoreceptor, sign | 99.78 | |
| 3nja_A | 125 | Probable ggdef family protein; structural genomics | 99.77 | |
| 4dj2_A | 320 | Period circadian protein homolog 1; PAS domains, c | 99.77 | |
| 2vv6_A | 119 | FIXL, sensor protein FIXL; signaling protein, tran | 99.77 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 99.77 | |
| 3mqq_A | 120 | Transcriptional regulator, LUXR family; PAS domain | 99.77 | |
| 3lyx_A | 124 | Sensory BOX/ggdef domain protein; structural genom | 99.77 | |
| 3h9w_A | 115 | Diguanylate cyclase with PAS/PAC sensor; alpha-bet | 99.76 | |
| 1d06_A | 130 | Nitrogen fixation regulatory protein FIXL; oxygen | 99.76 | |
| 2r78_A | 117 | Sensor protein; sensory box sensor histidine kinas | 99.75 | |
| 3kx0_X | 185 | Uncharacterized protein RV1364C/MT1410; PAS domain | 99.75 | |
| 2v0u_A | 146 | NPH1-1, LOV2; kinase, transferase, ATP-binding, se | 99.75 | |
| 3mxq_A | 152 | Sensor protein; PSI2, MCSG, structural genomics, p | 99.75 | |
| 2z6d_A | 130 | Phototropin-2; PAS-fold, LOV-fold, alternative spl | 99.75 | |
| 2z6d_A | 130 | Phototropin-2; PAS-fold, LOV-fold, alternative spl | 99.74 | |
| 3lyx_A | 124 | Sensory BOX/ggdef domain protein; structural genom | 99.74 | |
| 3icy_A | 118 | Sensor protein; sensory box histidine kinase/respo | 99.74 | |
| 3luq_A | 114 | Sensor protein; PAS, histidine, kinase, PSI, MCSG, | 99.74 | |
| 3k3c_A | 158 | Protein RV1364C/MT1410; sensor, PAS, signal transd | 99.73 | |
| 2r78_A | 117 | Sensor protein; sensory box sensor histidine kinas | 99.73 | |
| 3sw1_A | 162 | Sensory box protein; light-oxygen-voltage, LOV, PA | 99.73 | |
| 2vv6_A | 119 | FIXL, sensor protein FIXL; signaling protein, tran | 99.72 | |
| 2kdk_A | 121 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.71 | |
| 3mxq_A | 152 | Sensor protein; PSI2, MCSG, structural genomics, p | 99.71 | |
| 3luq_A | 114 | Sensor protein; PAS, histidine, kinase, PSI, MCSG, | 99.71 | |
| 3kx0_X | 185 | Uncharacterized protein RV1364C/MT1410; PAS domain | 99.71 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 99.7 | |
| 3icy_A | 118 | Sensor protein; sensory box histidine kinase/respo | 99.7 | |
| 2kdk_A | 121 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.7 | |
| 1d06_A | 130 | Nitrogen fixation regulatory protein FIXL; oxygen | 99.7 | |
| 2v0u_A | 146 | NPH1-1, LOV2; kinase, transferase, ATP-binding, se | 99.69 | |
| 3mjq_A | 126 | Uncharacterized protein; NESG, structural genomics | 99.68 | |
| 3olo_A | 118 | Two-component sensor histidine kinase; structural | 99.67 | |
| 3eeh_A | 125 | Putative light and redox sensing histidine kinase; | 99.66 | |
| 1byw_A | 110 | Protein (human ERG potassium channel); PAS domain, | 99.65 | |
| 1byw_A | 110 | Protein (human ERG potassium channel); PAS domain, | 99.65 | |
| 3bwl_A | 126 | Sensor protein; structural genomics, APC87707.1, P | 99.65 | |
| 2l0w_A | 138 | Potassium voltage-gated channel, subfamily H (EAG | 99.65 | |
| 4eho_A | 635 | Bacteriophytochrome, PAS/PAC sensor; photoreceptor | 99.65 | |
| 3eeh_A | 125 | Putative light and redox sensing histidine kinase; | 99.64 | |
| 3mjq_A | 126 | Uncharacterized protein; NESG, structural genomics | 99.63 | |
| 2l0w_A | 138 | Potassium voltage-gated channel, subfamily H (EAG | 99.62 | |
| 3olo_A | 118 | Two-component sensor histidine kinase; structural | 99.62 | |
| 1v9y_A | 167 | Heme PAS sensor protein; signaling protein; HET: H | 99.6 | |
| 3d72_A | 149 | Vivid PAS protein VVD; circadian, photoreceptor, b | 99.6 | |
| 3mfx_A | 129 | Sensory BOX/ggdef family protein; alpha-beta prote | 99.6 | |
| 4eho_A | 635 | Bacteriophytochrome, PAS/PAC sensor; photoreceptor | 99.6 | |
| 3vol_A | 233 | Aerotaxis transducer AER2; heme, oxygen sensor pro | 99.59 | |
| 3bwl_A | 126 | Sensor protein; structural genomics, APC87707.1, P | 99.58 | |
| 3d72_A | 149 | Vivid PAS protein VVD; circadian, photoreceptor, b | 99.58 | |
| 3mfx_A | 129 | Sensory BOX/ggdef family protein; alpha-beta prote | 99.58 | |
| 3fc7_A | 125 | HTR-like protein, sensor protein; APC87712.1, HTR- | 99.58 | |
| 2vlg_A | 111 | Sporulation kinase A; histidine kinase, two-compon | 99.56 | |
| 1v9y_A | 167 | Heme PAS sensor protein; signaling protein; HET: H | 99.56 | |
| 3fg8_A | 118 | Uncharacterized protein RHA05790; PAS domain, stru | 99.55 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 99.55 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 99.54 | |
| 3vol_A | 233 | Aerotaxis transducer AER2; heme, oxygen sensor pro | 99.54 | |
| 2vlg_A | 111 | Sporulation kinase A; histidine kinase, two-compon | 99.52 | |
| 4hi4_A | 121 | Aerotaxis transducer AER2; PAS domain, diatomic GA | 99.52 | |
| 2qkp_A | 151 | Uncharacterized protein; structural genomics, unkn | 99.5 | |
| 2qkp_A | 151 | Uncharacterized protein; structural genomics, unkn | 99.5 | |
| 4hi4_A | 121 | Aerotaxis transducer AER2; PAS domain, diatomic GA | 99.5 | |
| 3fg8_A | 118 | Uncharacterized protein RHA05790; PAS domain, stru | 99.49 | |
| 3fc7_A | 125 | HTR-like protein, sensor protein; APC87712.1, HTR- | 99.46 | |
| 3b33_A | 115 | Sensor protein; structural genomics, PAS domain, n | 99.45 | |
| 3b33_A | 115 | Sensor protein; structural genomics, PAS domain, n | 99.43 | |
| 3rty_A | 339 | Period circadian protein; PAS domain, signalling, | 99.39 | |
| 2ykf_A | 305 | Pdtas, probable sensor histidine kinase pdtas; tra | 99.05 | |
| 1ll8_A | 114 | PAS kinase; PAS domain, ligand binding, ligand scr | 99.36 | |
| 1ll8_A | 114 | PAS kinase; PAS domain, ligand binding, ligand scr | 99.33 | |
| 3cax_A | 369 | Uncharacterized protein PF0695; structural genomic | 99.33 | |
| 3a0r_A | 349 | Sensor protein; four helix bundle, PAS fold, kinas | 99.31 | |
| 2w0n_A | 118 | Sensor protein DCUS; signal transduction, two-comp | 99.29 | |
| 3cax_A | 369 | Uncharacterized protein PF0695; structural genomic | 99.27 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 99.26 | |
| 3a0s_A | 96 | Sensor protein; PAS-fold, kinase, phosphoprotein, | 99.24 | |
| 1nwz_A | 125 | PYP, photoactive yellow protein; PAS, LOV, GAF, do | 99.24 | |
| 1mzu_A | 129 | PPR; photoactive yellow protein, PAS, PYP, signali | 99.23 | |
| 3a0r_A | 349 | Sensor protein; four helix bundle, PAS fold, kinas | 99.23 | |
| 4dj3_A | 317 | Period circadian protein homolog 3; PAS domain, ci | 99.22 | |
| 3a0s_A | 96 | Sensor protein; PAS-fold, kinase, phosphoprotein, | 99.22 | |
| 2w0n_A | 118 | Sensor protein DCUS; signal transduction, two-comp | 99.17 | |
| 1nwz_A | 125 | PYP, photoactive yellow protein; PAS, LOV, GAF, do | 99.16 | |
| 3gdi_A | 309 | Period circadian protein homolog 2; tandem PAS dom | 99.15 | |
| 4dj2_A | 320 | Period circadian protein homolog 1; PAS domains, c | 99.14 | |
| 1mzu_A | 129 | PPR; photoactive yellow protein, PAS, PYP, signali | 99.13 | |
| 2jhe_A | 190 | Transcription regulator TYRR; aromatic hydrocarbon | 99.13 | |
| 2ykf_A | 305 | Pdtas, probable sensor histidine kinase pdtas; tra | 98.05 | |
| 1oj5_A | 132 | Steroid receptor coactivator 1A; transcriptional c | 98.36 | |
| 1oj5_A | 132 | Steroid receptor coactivator 1A; transcriptional c | 98.32 | |
| 2ool_A | 337 | Sensor protein; bacteriophytochrome, photoconversi | 94.97 | |
| 2ool_A | 337 | Sensor protein; bacteriophytochrome, photoconversi | 94.77 | |
| 4dah_A | 217 | Sporulation kinase D; alpha-beta-alpha structure, | 90.64 | |
| 2hje_A | 221 | Autoinducer 2 sensor kinase/phosphatase LUXQ; PER/ | 88.81 | |
| 4dah_A | 217 | Sporulation kinase D; alpha-beta-alpha structure, | 86.17 | |
| 1p0z_A | 131 | Sensor kinase CITA; transferase; HET: FLC MO7; 1.6 | 85.93 | |
| 3c38_A | 270 | Autoinducer 2 sensor kinase/phosphatase LUXQ; 2-co | 85.14 | |
| 1p0z_A | 131 | Sensor kinase CITA; transferase; HET: FLC MO7; 1.6 | 83.91 | |
| 4e04_A | 327 | Bacteriophytochrome (light-regulated signal trans | 83.32 | |
| 3e4o_A | 305 | C4-dicarboxylate transport sensor protein DCTB; PA | 82.95 | |
| 4ew7_A | 127 | Conjugative transfer: regulation; alpha-beta-alpha | 81.17 |
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-35 Score=249.26 Aligned_cols=221 Identities=20% Similarity=0.423 Sum_probs=199.0
Q ss_pred eEEEEcCCCCCCcEEEechhhHHhcCCCcchhcCCCCccccCCCCChhHHHHHHHHHHhCCCeeEEEeeEecCCCeEEEE
Q 016148 30 SFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWML 109 (394)
Q Consensus 30 ~i~~~d~~~~d~~i~~~N~a~~~~~G~~~~e~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~dG~~~~v~ 109 (394)
.|+++|.+ |+|+++|++|++++||++++++|+++..+.++.........+...+..+..+..++..+++||+.+|+.
T Consensus 1 ~i~i~D~~---g~i~~~N~a~~~l~Gy~~~el~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~dG~~~~~~ 77 (227)
T 3ewk_A 1 LVSITDLQ---GRILYANDNFCAVSRYGREELVGQDHRIVNSGYHGKAYIRDMWRTISRGNIWQGEFCNRRKDGTRYWVD 77 (227)
T ss_dssp CEEEEETT---CBEEEECHHHHHHTTCCHHHHTTSBGGGGCCSCSCHHHHHHHHHHHTTTCCEEEEEEEECSSSCEEEEE
T ss_pred CEEEECCC---CcEEehHHHHHHHHCcCHHHHcCCCHHHcCCCCCCHHHHHHHHHHHHcCCeEEEEEEEEcCCCCEEeee
Confidence 37889998 999999999999999999999999988777777777777778888888999999999999999999999
Q ss_pred EEEEeeeccCCCeeeEEEEEecccccccccccccCcccccCCCCchhHHHhhhhhhhhhhhhhhhhhhhcccCCCCCCCc
Q 016148 110 FKMSLVFGKEDGRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLALDSDDTGLE 189 (394)
Q Consensus 110 ~~~~~i~~~~~g~~~~~~~~~~DITe~k~~e~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~e~~~~~~~~~~~~~~~ 189 (394)
.+..|+++ .+|.+.+++++.+|||++|++
T Consensus 78 ~~~~p~~d-~~g~~~~~~~~~~DIT~~k~~-------------------------------------------------- 106 (227)
T 3ewk_A 78 STIVPLMD-NAGKPRQYISIRRDITAQKEA-------------------------------------------------- 106 (227)
T ss_dssp EEEEEEEC-SSSCEEEEEEEEEECTTTTHH--------------------------------------------------
T ss_pred eEEEEEEc-CCCCEEEEEEEEEehhhHHHH--------------------------------------------------
Confidence 99999999 999999999999999999985
Q ss_pred cccchhhhHHHHHHhHhhhhhHHHhhhhccccccceeeccccCCcchhhhHHHHHHHHhcccceEEEEcCCCCCcCEEEe
Q 016148 190 IEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQSFVLIDPHLPDMPMVYA 269 (394)
Q Consensus 190 ~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~d~~~~dg~i~~~ 269 (394)
+..++. +..++++++++|+++|. +|+|+++
T Consensus 107 --------e~~l~~---------------------------------------~~~~~~~~~~~i~~~d~---~g~i~~~ 136 (227)
T 3ewk_A 107 --------EAQLAR---------------------------------------LKQAMDANSEMILLTDR---AGRIIYA 136 (227)
T ss_dssp --------HHHHHH---------------------------------------HHHHHHTCCSEEEEECT---TSCEEEE
T ss_pred --------HHHHHH---------------------------------------HHHHHhcCcCeEEEEcC---CCcEEEE
Confidence 222211 23346788999999998 7999999
Q ss_pred CHHHHHHhcCCchhhcCCcccccccCCCchhHHHHHHHHHhccCeeeEEEEEEecCCC------eeEEEEEeeeeecCCC
Q 016148 270 SDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQTEQACTVRILNYRKDKS------SFWNLLHISPIRNASG 343 (394)
Q Consensus 270 N~~~~~~~G~~~~e~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~G~------~~~~~~~~~~i~d~~g 343 (394)
|+++++++||++++++|+++..+.++...+.....+.+.+..+.++.+++..++++|. .+|+.+++.|+.|.+|
T Consensus 137 N~~~~~~~G~~~~e~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~k~G~~~~dg~~~~~~~~~~pi~d~~g 216 (227)
T 3ewk_A 137 NPALCRFSGMAEGELLGQSPSILDSPLADQETLAAMQEALQAGQPWSGRLLNRRRTGPAPHDAEDYWAEISTTPIHTDGN 216 (227)
T ss_dssp CHHHHHHHTCCTHHHHSSCGGGGBCTTSCHHHHHHHHHHHHHTCCEECCEEEEEECCSSSSCEEEEEEEEEEEEEECSSS
T ss_pred chHHHHHhCCCHHHHcCCChhhccCCCCCHHHHHHHHHHHHcCCceeEEEEEECCCCCcCcccceEEEEEEEEEEECCCC
Confidence 9999999999999999999988888888888888999999999999999999999997 8999999999999999
Q ss_pred CEEEEEEEEee
Q 016148 344 KIAYFAAVHTE 354 (394)
Q Consensus 344 ~~~~~~~~~~D 354 (394)
.+.+++++.+|
T Consensus 217 ~~~~~v~i~~D 227 (227)
T 3ewk_A 217 GLVGYVQIQHD 227 (227)
T ss_dssp CEEEEEEEEEC
T ss_pred CEEEEEEEecC
Confidence 99999999987
|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* | Back alignment and structure |
|---|
| >3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A | Back alignment and structure |
|---|
| >2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B | Back alignment and structure |
|---|
| >4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* | Back alignment and structure |
|---|
| >1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* | Back alignment and structure |
|---|
| >1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* | Back alignment and structure |
|---|
| >3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} | Back alignment and structure |
|---|
| >4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* | Back alignment and structure |
|---|
| >3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B | Back alignment and structure |
|---|
| >4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} | Back alignment and structure |
|---|
| >2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* | Back alignment and structure |
|---|
| >3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A | Back alignment and structure |
|---|
| >3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A | Back alignment and structure |
|---|
| >3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* | Back alignment and structure |
|---|
| >3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} | Back alignment and structure |
|---|
| >3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* | Back alignment and structure |
|---|
| >3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} | Back alignment and structure |
|---|
| >4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* | Back alignment and structure |
|---|
| >3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A | Back alignment and structure |
|---|
| >3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A | Back alignment and structure |
|---|
| >4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* | Back alignment and structure |
|---|
| >3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A | Back alignment and structure |
|---|
| >3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* | Back alignment and structure |
|---|
| >2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* | Back alignment and structure |
|---|
| >3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* | Back alignment and structure |
|---|
| >2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* | Back alignment and structure |
|---|
| >3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A | Back alignment and structure |
|---|
| >2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* | Back alignment and structure |
|---|
| >2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* | Back alignment and structure |
|---|
| >2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* | Back alignment and structure |
|---|
| >3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} | Back alignment and structure |
|---|
| >3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} | Back alignment and structure |
|---|
| >1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 | Back alignment and structure |
|---|
| >1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 | Back alignment and structure |
|---|
| >3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A | Back alignment and structure |
|---|
| >3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} | Back alignment and structure |
|---|
| >3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A | Back alignment and structure |
|---|
| >3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} | Back alignment and structure |
|---|
| >1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* | Back alignment and structure |
|---|
| >3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* | Back alignment and structure |
|---|
| >3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} | Back alignment and structure |
|---|
| >3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* | Back alignment and structure |
|---|
| >3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} | Back alignment and structure |
|---|
| >2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* | Back alignment and structure |
|---|
| >3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} | Back alignment and structure |
|---|
| >4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} | Back alignment and structure |
|---|
| >3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A | Back alignment and structure |
|---|
| >2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A | Back alignment and structure |
|---|
| >1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 | Back alignment and structure |
|---|
| >1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 | Back alignment and structure |
|---|
| >3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* | Back alignment and structure |
|---|
| >1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... | Back alignment and structure |
|---|
| >1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 | Back alignment and structure |
|---|
| >3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* | Back alignment and structure |
|---|
| >2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... | Back alignment and structure |
|---|
| >3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 | Back alignment and structure |
|---|
| >2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A | Back alignment and structure |
|---|
| >1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 | Back alignment and structure |
|---|
| >1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 | Back alignment and structure |
|---|
| >2ool_A Sensor protein; bacteriophytochrome, photoconversion, photoreceptor, biliver signaling protein; HET: LBV; 2.20A {Rhodopseudomonas palustris} SCOP: d.110.2.1 d.110.3.9 | Back alignment and structure |
|---|
| >2ool_A Sensor protein; bacteriophytochrome, photoconversion, photoreceptor, biliver signaling protein; HET: LBV; 2.20A {Rhodopseudomonas palustris} SCOP: d.110.2.1 d.110.3.9 | Back alignment and structure |
|---|
| >2hje_A Autoinducer 2 sensor kinase/phosphatase LUXQ; PER/ARNT/simple-minded (PAS) fold, autoinducer-2 (AI-2), quorum sensing, histidine sensor kinase; 1.70A {Vibrio harveyi} SCOP: d.110.6.3 PDB: 2hj9_C 1zhh_B* | Back alignment and structure |
|---|
| >1p0z_A Sensor kinase CITA; transferase; HET: FLC MO7; 1.60A {Klebsiella pneumoniae} SCOP: d.110.6.1 PDB: 2v9a_A 2j80_A* | Back alignment and structure |
|---|
| >3c38_A Autoinducer 2 sensor kinase/phosphatase LUXQ; 2-component system, quorum sensing, histidine kinase, hydrolase, inner membrane, membrane; 2.30A {Vibrio cholerae} PDB: 3c30_A | Back alignment and structure |
|---|
| >1p0z_A Sensor kinase CITA; transferase; HET: FLC MO7; 1.60A {Klebsiella pneumoniae} SCOP: d.110.6.1 PDB: 2v9a_A 2j80_A* | Back alignment and structure |
|---|
| >4e04_A Bacteriophytochrome (light-regulated signal trans histidine kinase), PHYB1; bacteriophytochrome chromophore binding domain; HET: LBV; 1.79A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3e4o_A C4-dicarboxylate transport sensor protein DCTB; PAS domain, N-TERM helical dimerization domain, transferase; 2.30A {Sinorhizobium meliloti} PDB: 3e4p_A 3e4q_A 2zbb_A | Back alignment and structure |
|---|
| >4ew7_A Conjugative transfer: regulation; alpha-beta-alpha structure, structural genomics, midwest CEN structural genomics (MCSG), PSI-biology; 1.67A {Salmonella enterica subsp} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 394 | ||||
| d1jnua_ | 104 | d.110.3.6 (A:) Photoreceptor phy3 flavin-binding d | 1e-20 | |
| d1jnua_ | 104 | d.110.3.6 (A:) Photoreceptor phy3 flavin-binding d | 1e-15 | |
| d1n9la_ | 109 | d.110.3.6 (A:) Putative blue light receptor, phot- | 2e-20 | |
| d1n9la_ | 109 | d.110.3.6 (A:) Putative blue light receptor, phot- | 9e-18 | |
| d1bywa_ | 110 | d.110.3.6 (A:) Erg potassium channel, N-terminal d | 6e-13 | |
| d1bywa_ | 110 | d.110.3.6 (A:) Erg potassium channel, N-terminal d | 7e-10 | |
| d1p97a_ | 114 | d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-t | 4e-05 | |
| d1p97a_ | 114 | d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-t | 0.003 | |
| d1mzua_ | 110 | d.110.3.1 (A:) PYP domain of sensor histidine kina | 4e-04 | |
| d1xj3a1 | 106 | d.110.3.2 (A:154-259) Histidine kinase FixL heme d | 0.001 |
| >d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Length = 104 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Profilin-like superfamily: PYP-like sensor domain (PAS domain) family: Flavin-binding PAS domain domain: Photoreceptor phy3 flavin-binding domain, lov2 species: Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]
Score = 83.8 bits (206), Expect = 1e-20
Identities = 47/103 (45%), Positives = 70/103 (67%)
Query: 252 QSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQT 311
+SFV+ DP LPD P+++ASD FL+LT Y R EV+G NCRFL G TD + I+++++
Sbjct: 1 KSFVITDPRLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDAVKE 60
Query: 312 EQACTVRILNYRKDKSSFWNLLHISPIRNASGKIAYFAAVHTE 354
++ TV++LNY K +FWNL H+ +R+ +G + YF V E
Sbjct: 61 QRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQE 103
|
| >d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 109 | Back information, alignment and structure |
|---|
| >d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 109 | Back information, alignment and structure |
|---|
| >d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Length = 110 | Back information, alignment and structure |
|---|
| >d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Length = 106 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 394 | |||
| d1n9la_ | 109 | Putative blue light receptor, phot-lov1 domain {Gr | 99.9 | |
| d1n9la_ | 109 | Putative blue light receptor, phot-lov1 domain {Gr | 99.9 | |
| d1bywa_ | 110 | Erg potassium channel, N-terminal domain {Human (H | 99.86 | |
| d1bywa_ | 110 | Erg potassium channel, N-terminal domain {Human (H | 99.86 | |
| d1jnua_ | 104 | Photoreceptor phy3 flavin-binding domain, lov2 {Ma | 99.85 | |
| d1jnua_ | 104 | Photoreceptor phy3 flavin-binding domain, lov2 {Ma | 99.85 | |
| d1ew0a_ | 130 | Histidine kinase FixL heme domain {Rhizobium melil | 99.81 | |
| d1p97a_ | 114 | Hypoxia-inducible factor Hif2a, C-terminal domain | 99.79 | |
| d1p97a_ | 114 | Hypoxia-inducible factor Hif2a, C-terminal domain | 99.79 | |
| d1ew0a_ | 130 | Histidine kinase FixL heme domain {Rhizobium melil | 99.75 | |
| d1v9ya_ | 113 | Direct oxygen sensor protein, DOS {Escherichia col | 99.7 | |
| d1xj3a1 | 106 | Histidine kinase FixL heme domain {Bradyrhizobium | 99.69 | |
| d1xj3a1 | 106 | Histidine kinase FixL heme domain {Bradyrhizobium | 99.67 | |
| d1v9ya_ | 113 | Direct oxygen sensor protein, DOS {Escherichia col | 99.67 | |
| d1nwza_ | 125 | Photoactive yellow protein, PYP {Ectothiorhodospir | 99.62 | |
| d1mzua_ | 110 | PYP domain of sensor histidine kinase Ppr {Rhodosp | 99.58 | |
| d1nwza_ | 125 | Photoactive yellow protein, PYP {Ectothiorhodospir | 99.54 | |
| d1mzua_ | 110 | PYP domain of sensor histidine kinase Ppr {Rhodosp | 99.5 | |
| d1ll8a_ | 114 | N-terminal PAS domain of Pas kinase {Human (Homo s | 99.49 | |
| d1ll8a_ | 114 | N-terminal PAS domain of Pas kinase {Human (Homo s | 99.47 | |
| d1oj5a_ | 109 | PAS domain of steroid receptor coactivator 1A, NCo | 99.41 | |
| d1oj5a_ | 109 | PAS domain of steroid receptor coactivator 1A, NCo | 99.34 | |
| d2oola2 | 114 | Sensor protein PhyB2 {Rhodopseudomonas palustris [ | 97.68 | |
| d2oola2 | 114 | Sensor protein PhyB2 {Rhodopseudomonas palustris [ | 97.54 | |
| d2veaa3 | 127 | Phytochrome-like protein Cph1 {Synechocystis sp. p | 96.02 | |
| d2veaa3 | 127 | Phytochrome-like protein Cph1 {Synechocystis sp. p | 95.2 | |
| d2o9ca2 | 127 | Bacteriophytochrome BphP {Deinococcus radiodurans | 95.06 | |
| d2o9ca2 | 127 | Bacteriophytochrome BphP {Deinococcus radiodurans | 94.79 | |
| d3c2wa3 | 113 | Bacteriophytochrome BphP {Pseudomonas aeruginosa [ | 89.7 | |
| d1p0za_ | 131 | Sensor kinase CitA {Klebsiella pneumoniae [TaxId: | 84.98 | |
| d3c2wa3 | 113 | Bacteriophytochrome BphP {Pseudomonas aeruginosa [ | 83.06 |
| >d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Profilin-like superfamily: PYP-like sensor domain (PAS domain) family: Flavin-binding PAS domain domain: Putative blue light receptor, phot-lov1 domain species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]
Probab=99.90 E-value=3e-23 Score=150.04 Aligned_cols=108 Identities=44% Similarity=0.942 Sum_probs=101.7
Q ss_pred ccceEEEEcCCCCCcCEEEeCHHHHHHhcCCchhhcCCcccccccCCCchhHHHHHHHHHhccCeeeEEEEEEecCCCee
Q 016148 250 IKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQTEQACTVRILNYRKDKSSF 329 (394)
Q Consensus 250 ~~~~i~~~d~~~~dg~i~~~N~~~~~~~G~~~~e~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~G~~~ 329 (394)
+.++++++|...|||+|+|+|++|++++||+++|++|+++..+.+|+..+.....+...+..+.++.++++.+++||+.+
T Consensus 2 i~~~~vi~Da~~pdg~Ii~vN~a~~~~~Gy~~~El~G~~~~~l~~~~~~~~~~~~~~~~l~~~~~~~~e~~~~~kdG~~~ 81 (109)
T d1n9la_ 2 LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPF 81 (109)
T ss_dssp CSCEEEEEETTSTTCCEEEECHHHHHHHCCCHHHHTTSCGGGGCCTTCCHHHHHHHHHHHHHTCCEEEEEEEECTTSCEE
T ss_pred ccceEEEEeCCCCCCeEEEEcHHHHHHHCcCHHHHcCCcceeeecccCCHHHhhhhhhHhhcCCceeeeEEEEecCCeEE
Confidence 35799999987779999999999999999999999999999888888888888899999999999999999999999999
Q ss_pred EEEEEeeeeecCCCCEEEEEEEEeecch
Q 016148 330 WNLLHISPIRNASGKIAYFAAVHTEEGC 357 (394)
Q Consensus 330 ~~~~~~~~i~d~~g~~~~~~~~~~DIT~ 357 (394)
|+.++..|++|++|++.+++++++|||.
T Consensus 82 w~~~~~~pi~d~~G~v~~~v~~~~DITa 109 (109)
T d1n9la_ 82 WNLLTVTPIKTPDGRVSKFVGVQVDVTS 109 (109)
T ss_dssp EEEEEEEEEECTTSCEEEEEEEEEECCC
T ss_pred EEEEEEEEEECCCCCEEEEEEEEEECCC
Confidence 9999999999999999999999999994
|
| >d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} | Back information, alignment and structure |
|---|
| >d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} | Back information, alignment and structure |
|---|
| >d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} | Back information, alignment and structure |
|---|
| >d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} | Back information, alignment and structure |
|---|
| >d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} | Back information, alignment and structure |
|---|
| >d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} | Back information, alignment and structure |
|---|
| >d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d2veaa3 d.110.3.9 (A:4-130) Phytochrome-like protein Cph1 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2veaa3 d.110.3.9 (A:4-130) Phytochrome-like protein Cph1 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d3c2wa3 d.110.3.9 (A:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1p0za_ d.110.6.1 (A:) Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d3c2wa3 d.110.3.9 (A:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|