Citrus Sinensis ID: 016175


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MALSKLSSPSSLSTNILKPLTNSFLLHRPISTDTTPLTIETSVPFTSHQCEAPSRSVETTPKELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAKESPMPEPSELFTNVYVKGYGVEVFGADRKEVRSALP
cccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccHHHHHHHHHHccccccEEEEcccccHHHHcccccHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHccccHHHHccccccccEEccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccccccccccHHHHccccc
***********************FLLHRPISTDTTPLTIE****F****************KELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAKESPMPEPSELFTNVYVKGYGVEVFGADRK*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSKLSSPSSLSTNILKPLTNSFLLHRPISTDTTPLTIETSVPFTSHQCEAPSRSVETTPKELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAKESPMPEPSELFTNVYVKGYGVEVFGADRKEVRSALP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).confidentQ6Z5N4
Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).confidentP52901
Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).probableP52899

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.2.-.-Acting on the aldehyde or oxo group of donors.probable
1.2.4.-2,4'-dihydroxyacetophenone dioxygenase.probable
1.2.4.1Pyruvate dehydrogenase (acetyl-transferring).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OZL, chain A
Confidence level:very confident
Coverage over the Query: 34-385
View the alignment between query and template
View the model in PyMOL