Citrus Sinensis ID: 016179


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MGLFALQWQRRNMSASSRSRSVIEGAIKDGELRVFIVAGEVSGDSIGSRLMSAMKKLAPLPVSFSGVGGSMMSEQGMKSLFPMEDIAVMGIWELLPHIYKFRVRLKETIEAALLFRPHAVVTVDSKGFSFRLLKQLRARYSHERLNGPAHFHYVAPSFWAWKGGEARLKNLAAFVDHILCILPNEEAICRLNGLAATFVGHPVVEDCLELNLGKGPEPCELKMEGNSEDFKNKYSVPSGATVISLLPGSRLQEVARMLPIFAKTVELLKDSFPELITVIHVAPNRHVENYITGLIQKWPVPSILVPGGSSNLKYDAFSASRVALCTSGTVAVELQLARLPCVVAYRAHFLTEWFIRYKAKIPYISLPNILLDSPIIPEALLQACTPDTLTHLLM
ccHHHHHHHHHHccccccccHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHHHHcccccEEEECccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHcccccHHHHHHcccccEEEcccccccccccccccccccccccccccHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEECcccccHHHHHHHHHHcccccCEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHccccccccccHHHHcccccccccccccccHHHHHHHHc
**********************IEGAIKDGELRVFIVAGEVSGDSIGSRLMSAMKKLAPLPVSFSGVGGSMMSEQGMKSLFPMEDIAVMGIWELLPHIYKFRVRLKETIEAALLFRPHAVVTVDSKGFSFRLLKQLRARYSHERLNGPAHFHYVAPSFWAWKGGEARLKNLAAFVDHILCILPNEEAICRLNGLAATFVGHPVVEDCLELNLGKGPEPC***MEGNSEDFKNKYSVPSGATVISLLPGSRLQEVARMLPIFAKTVELLKDSFPELITVIHVAPNRHVENYITGLIQKWPVPSILVPGGSSNLKYDAFSASRVALCTSGTVAVELQLARLPCVVAYRAHFLTEWFIRYKAKIPYISLPNILLDSPIIPEALLQACTPDTLTHLLM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLFALQWQRRNMSASSRSRSVIEGAIKDGELRVFIVAGEVSGDSIGSRLMSAMKKLAPLPVSFSGVGGSMMSEQGMKSLFPMEDIAVMGIWELLPHIYKFRVRLKETIEAALLFRPHAVVTVDSKGFSFRLLKQLRARYSHERLNGPAHFHYVAPSFWAWKGGEARLKNLAAFVDHILCILPNEEAICRLNGLAATFVGHPVVEDCLELNLGKGPEPCELKMEGNSEDFKNKYSVPSGATVISLLPGSRLQEVARMLPIFAKTVELLKDSFPELITVIHVAPNRHVENYITGLIQKWPVPSILVPGGSSNLKYDAFSASRVALCTSGTVAVELQLARLPCVVAYRAHFLTEWFIRYKAKIPYISLPNILLDSPIIPEALLQACTPDTLTHLLM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable lipid-A-disaccharide synthase, mitochondrial Condensation of UDP-2,3-diacylglucosamine and 2,3-diacylglucosamine-1-phosphate to form lipid A disaccharide, a precursor of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell. Lipid A-like molecules in plants may serve as structural components of the outer membranes of mitochondria and/or chloroplasts, or may be involved in signal transduction or plant defense responses.probableF4IF99
Lipid-A-disaccharide synthase Condensation of UDP-2,3-diacylglucosamine and 2,3-diacylglucosamine-1-phosphate to form lipid A disaccharide, a precursor of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell.probableQ5QYW1
Lipid-A-disaccharide synthase Condensation of UDP-2,3-diacylglucosamine and 2,3-diacylglucosamine-1-phosphate to form lipid A disaccharide, a precursor of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell.probableQ3SRI5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.182Lipid-A-disaccharide synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S2U, chain A
Confidence level:confident
Coverage over the Query: 32-209,229-360
View the alignment between query and template
View the model in PyMOL
Template: 3FRO, chain A
Confidence level:confident
Coverage over the Query: 31-354
View the alignment between query and template
View the model in PyMOL
Template: 3QUA, chain A
Confidence level:probable
Coverage over the Query: 313-393
View the alignment between query and template
View the model in PyMOL