Citrus Sinensis ID: 016207


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---
MGFKEQEKKSGVREKMRVGVAMSSMKKKRFVFALVLSLIIDVGFAGRVVVPLLQSYEKASYSRGFSRNFGKIFDTSNYGILQLNNGLASTPQMGWNSWNFFACNISETIIKETADALVSTGLAELGYDHVNIDDCWSSPLRDLKGQLVPDTITFPSGIKALADYVHGKGLKLGIYSDAGVFTCQVRPGSLFHEKDDAPLFASWGVDYLKYDNCFNLGIEPKKRYPPMRDALNETGCSIFYSLCEWGVDDPALWAGKVGNSWRTTGDINDTWASMTSIADINDKWASYAGPGGWNDPDMLEVGNGGMSYQEYRAHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKVFGWVLCLDIAWWLLSGIDVQKLKLSQHNGMH
cccHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEECcccccccccccccccccccccccccHHHHHHHHHHcccEEEEEEccccccccccccccccHHccHHHHHHccccEEccccccccccccccccHHHHHHHHHHccccEEEccccccccccccHHHcccEEECcccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHccHHHHHHcccccccccEEEEEEccccEEEEEEcccccEEEEEEEcccccc
**************************KKRFVFALVLSLIIDVGFAGRVVVPLLQSYEKASYSRGFSRNFGKIFDTSNYGILQLNNGLASTPQMGWNSWNFFACNISETIIKETADALVSTGLAELGYDHVNIDDCWSSPLRDLKGQLVPDTITFPSGIKALADYVHGKGLKLGIYSDAGVFTCQVRPGSLFHEKDDAPLFASWGVDYLKYDNCFNLGIEPKKRYPPMRDALNETGCSIFYSLCEWGVDDPALWAGKVGNSWRTTGDINDTWASMTSIADINDKWASYAGPGGWNDPDMLEVGNGGMSYQEYRAHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKVFGWVLCLDIAWWLLSGIDVQKLKLSQHNG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFKEQEKKSGVREKMRVGVAMSSMKKKRFVFALVLSLIIDVGFAGRVVVPLLQSYEKASYSRGFSRNFGKIFDTSNYGILQLNNGLASTPQMGWNSWNFFACNISETIIKETADALVSTGLAELGYDHVNIDDCWSSPLRDLKGQLVPDTITFPSGIKALADYVHGKGLKLGIYSDAGVFTCQVRPGSLFHEKDDAPLFASWGVDYLKYDNCFNLGIEPKKRYPPMRDALNETGCSIFYSLCEWGVDDPALWAGKVGNSWRTTGDINDTWASMTSIADINDKWASYAGPGGWNDPDMLEVGNGGMSYQEYRAHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKVFGWVLCLDIAWWLLSGIDVQKLKLSQHNGMH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alpha-galactosidase Involved in the hydrolysis of the galactomannan, it splits alpha-linked galactose moieties. It is particularly suitable for the hydrolysis of guar gum to a gum with improved gelling properties. Preferentially cleaves alpha-1,6 glycoside linkages.probableP14749
Probable alpha-galactosidase probableQ55B10
Alpha-galactosidase A Hydrolyzes galactomannan found in plant cell wall, by cleaving alpha-1,6-D-galactose side-chains from the mannan backbone. Appears to act in synergy with mannanase (ManA) to elicit hydrolysis of galactomannan. Has greater activity against galactomannans with decreased degree of polymerisation values. To a lesser extent, is also able to degrade other galactosides containing alpha-1,6-linked D-galactose, such as melibiose and stachyose.probableB3PGJ1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.22Alpha-galactosidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UAS, chain A
Confidence level:very confident
Coverage over the Query: 84-391
View the alignment between query and template
View the model in PyMOL
Template: 2XN2, chain A
Confidence level:very confident
Coverage over the Query: 14-389
View the alignment between query and template
View the model in PyMOL