Citrus Sinensis ID: 016224

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---
MDFDAHGGNKRVFHRLGGGGGDGGGGGLSTADTRQKVCNYWRAGKCNRFPCPYLHRELPLPPAATANGAAAKRFANNTWGRNNNFNNHSNNYRAGNSKNSNINNRAVIKTDILCRNWVQGNCMYGEKCKFLHSWTVGDGFKLLTQLEGHQKVVSGITLPSGSDKLYSGSKDETVRVWDCASGQCAGVINLGGEVGCMISEGPWIFIGVTNFVKAWNTQTNTDLSLSGPVGQVYAMAVGNDLLFAGTQDGAILAWKFNVTTNCFEPAASLKGHSLAVVSLVVGANKLYSGSMDNSIRVWNLETLQCIQTLTEHTSVVMSLLCWDQFLLSCSLDKTIKVWFATDSGNLEVTYTHNEEHGVLALCGMPDSEGKPVLLCSCNDNSVRFYDLPSVIIC
cccccccccCEEEEEEccccccccccccccccccccEEEHHHccccccccccccccccccccccccccccEEEEECcccccccCCccccccEECccccccccccccCEEEEEEEECccccEEEEEcccccEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEccccCEEEEECcccEEEEEcccEEEEEEcccccEEEcccccccEEEEEEcccEEEECcccccEEEEEcccccccccccEEECcccccEEEEEEcccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccEEEEccccccEEEEEccccccEEEcccccccccEEEEEEccccccccEEEEECccccEEEEEccccccc
********N**************************KVCNYWRAGKCNRFPCPYLHRELPLPPAATANGAAAKRFANNTWGRNNNFNNHSNNYRAGNSKNSNINNRAVIKTDILCRNWVQGNCMYGEKCKFLHSWTVGDGFKLLTQLEGHQKVVSGITLPSGSDKLYSGSKDETVRVWDCASGQCAGVINLGGEVGCMISEGPWIFIGVTNFVKAWNTQTNTDLSLSGPVGQVYAMAVGNDLLFAGTQDGAILAWKFNVTTNCFEPAASLKGHSLAVVSLVVGANKLYSGSMDNSIRVWNLETLQCIQTLTEHTSVVMSLLCWDQFLLSCSLDKTIKVWFATDSGNLEVTYTHNEEHGVLALCGMPDSEGKPVLLCSCNDNSVRFYDLPSVIIC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFDAHGGNKRVFHRLGGGGGDGGGGGLSTADTRQKVCNYWRAGKCNRFPCPYLHRELPLPPAATANGAAAKRFANNTWGRNNNFNNHSNNYRAGNSKNSNINNRAVIKTDILCRNWVQGNCMYGEKCKFLHSWTVGDGFKLLTQLEGHQKVVSGITLPSGSDKLYSGSKDETVRVWDCASGQCAGVINLGGEVGCMISEGPWIFIGVTNFVKAWNTQTNTDLSLSGPVGQVYAMAVGNDLLFAGTQDGAILAWKFNVTTNCFEPAASLKGHSLAVVSLVVGANKLYSGSMDNSIRVWNLETLQCIQTLTEHTSVVMSLLCWDQFLLSCSLDKTIKVWFATDSGNLEVTYTHNEEHGVLALCGMPDSEGKPVLLCSCNDNSVRFYDLPSVIIC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 48 probableQ9FNZ2
Zinc finger CCCH domain-containing protein 17 probableQ0DYP5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 105-341
View the alignment between query and template
View the model in PyMOL
Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 105-390
View the alignment between query and template
View the model in PyMOL
Template: 2D9N, chain A
Confidence level:probable
Coverage over the Query: 29-60
View the alignment between query and template
View the model in PyMOL