Citrus Sinensis ID: 016230


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390---
MALKLNPTTFSFPSSSSSIRKHRCSRVFMASTLPPAITKEVGNLKKPYCPPREVHVQVTHSMPQQKMEIFKSLEGWAEENILVHLKPVEKCWQPMDYLPEPESEGFYEQVKELRERCKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASLTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMKQIEKTIQYLIGSGMDPKTENNPYLGFIYTSFQERATFISHGNTARHAKEYGDLKLAQICGIIASDEKRHETAYTKIVEKLFEIDPDGTVMALADMMKKKISMPAHLMYDGRDDNLFEHFSTVAQRLGVYTAKDYADILEFLVGRWNVEKLTGLSGEGRKAQDFVCGLPPRIRRLEERAQGRAKQASAVPFSWVFGREIIV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccEEECcccccc
**********************************************************THSMPQQKMEIFKSLEGWAEENILVHLKPVEKCWQPMDYLPEPESEGFYEQVKELRERCKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASLTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMKQIEKTIQYLIGSGMDPKTENNPYLGFIYTSFQERATFISHGNTARHAKEYGDLKLAQICGIIASDEKRHETAYTKIVEKLFEIDPDGTVMALADMMKKKISMPAHLMYDGRDDNLFEHFSTVAQRLGVYTAKDYADILEFLVGRWNVEKLTGLSGEGRKAQDFVCGLPPRIR**************AVPFSWVFGREIIV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALKLNPTTFSFPSSSSSIRKHRCSRVFMASTLPPAITKEVGNLKKPYCPPREVHVQVTHSMPQQKMEIFKSLEGWAEENILVHLKPVEKCWQPMDYLPEPESEGFYEQVKELRERCKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASLTSWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMKQIEKTIQYLIGSGMDPKTENNPYLGFIYTSFQERATFISHGNTARHAKEYGDLKLAQICGIIASDEKRHETAYTKIVEKLFEIDPDGTVMALADMMKKKISMPAHLMYDGRDDNLFEHFSTVAQRLGVYTAKDYADILEFLVGRWNVEKLTGLSGEGRKAQDFVCGLPPRIRRLEERAQGRAKQASAVPFSWVFGREIIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-[acyl-carrier-protein] desaturase 2, chloroplastic Converts stearoyl-ACP to oleoyl-ACP by introduction of a cis double bond between carbons Delta(9) and Delta(10) of the acyl chain. Required for the repression of the salicylic acid (SA) signaling pathway.confidentQ8S059
Acyl-[acyl-carrier-protein] desaturase, chloroplastic Converts stearoyl-ACP to oleoyl-ACP by introduction of a cis double bond between carbons Delta(9) and Delta(10) of the acyl chain.confidentQ42807
Acyl-[acyl-carrier-protein] desaturase 5, chloroplastic Converts stearoyl-ACP to oleoyl-ACP by introduction of a cis double bond between carbons Delta(9) and Delta(10) of the acyl chain.confidentQ9M879

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.19.-With oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water.probable
1.14.19.2Acyl-[acyl-carrier-protein] desaturase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2UW1, chain A
Confidence level:very confident
Coverage over the Query: 67-393
View the alignment between query and template
View the model in PyMOL
Template: 1OQ4, chain A
Confidence level:very confident
Coverage over the Query: 48-391
View the alignment between query and template
View the model in PyMOL