Citrus Sinensis ID: 016292
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 392 | 2.2.26 [Sep-21-2011] | |||||||
| P52711 | 516 | Serine carboxypeptidase I | N/A | no | 0.908 | 0.689 | 0.601 | 1e-123 | |
| Q0WRX3 | 502 | Serine carboxypeptidase-l | yes | no | 0.943 | 0.737 | 0.558 | 1e-119 | |
| Q9M099 | 465 | Serine carboxypeptidase 2 | no | no | 0.936 | 0.789 | 0.506 | 1e-110 | |
| Q9ZQQ0 | 452 | Serine carboxypeptidase-l | no | no | 0.941 | 0.816 | 0.492 | 1e-104 | |
| Q949Q7 | 479 | Serine carboxypeptidase-l | no | no | 0.903 | 0.739 | 0.489 | 1e-102 | |
| Q0WPR4 | 499 | Serine carboxypeptidase-l | no | no | 0.915 | 0.719 | 0.468 | 1e-102 | |
| Q1PF08 | 464 | Serine carboxypeptidase-l | no | no | 0.931 | 0.786 | 0.467 | 1e-101 | |
| Q9SFB5 | 459 | Serine carboxypeptidase-l | no | no | 0.913 | 0.779 | 0.498 | 1e-101 | |
| P55748 | 436 | Serine carboxypeptidase I | N/A | no | 0.913 | 0.821 | 0.494 | 1e-101 | |
| P08819 | 444 | Serine carboxypeptidase 2 | N/A | no | 0.908 | 0.801 | 0.485 | 1e-100 |
| >sp|P52711|CBP23_HORVU Serine carboxypeptidase II-3 OS=Hordeum vulgare GN=CXP;2-3 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 441 bits (1133), Expect = e-123, Method: Compositional matrix adjust.
Identities = 225/374 (60%), Positives = 269/374 (71%), Gaps = 18/374 (4%)
Query: 33 LSGGPGCSSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTS 92
L+GGPGCSSLGYGAMEELGPFRV SDGKTLY N Y+WN+ ANVLFLE+PAGVG+SYSNT+
Sbjct: 137 LNGGPGCSSLGYGAMEELGPFRVMSDGKTLYSNPYSWNHAANVLFLESPAGVGYSYSNTT 196
Query: 93 SDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSK 152
+DY GDN TAED+Y FL NW ERFP+YK R+F+ITGESYAGHYVPQLA+ IL +
Sbjct: 197 ADYGRSGDNGTAEDAYQFLDNWLERFPEYKGREFYITGESYAGHYVPQLAHAILRHASPD 256
Query: 153 TIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDF---ATGQLSTS- 208
INLKGI IGNA I+D +KGM+DFFWTHAL SDET I+K C+F G S +
Sbjct: 257 --INLKGIMIGNAVINDWTDSKGMYDFFWTHALISDETADGISKNCNFTAYGAGVASNAL 314
Query: 209 CDQYQTQGVREYGQIDLYNVYAPLCKSSA-PPPPTAGVIREYDPCSDKYVNSYLNLAEVQ 267
CD + ID+YN+YAP C+S PP A I +DPC+D YV +YLN +VQ
Sbjct: 315 CDAASDEVGESLADIDIYNIYAPNCQSEKLVTPPIAPSIDNFDPCTDYYVEAYLNRPDVQ 374
Query: 268 AALHAKHTN----WSTCSDL--TWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTS 321
ALHA T WS CSD+ W DS TVLP IQ+L+ + IRVW+YSGDTDGRVPVTS
Sbjct: 375 KALHANVTRLDHPWSACSDVLTRWVDSAKTVLPIIQELMKNSIRVWVYSGDTDGRVPVTS 434
Query: 322 SRYSINALNLPVETAWYPWYAD----GEVGGYVLGYKGVI-FTTVRGAGHLVPTYQPQRA 376
SR S+N L LPV W PW++ GEVGGY++ YKG + TVRGAGH VP+YQP+RA
Sbjct: 435 SRLSVNQLQLPVAAKWRPWFSSTKGAGEVGGYIVQYKGDLSLVTVRGAGHEVPSYQPRRA 494
Query: 377 LIMISSFLEGKLPP 390
L+++ +FL GK P
Sbjct: 495 LVLVQNFLAGKALP 508
|
Hordeum vulgare (taxid: 4513) EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: 6 |
| >sp|Q0WRX3|SCP40_ARATH Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9M099|SCP24_ARATH Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ZQQ0|SCP26_ARATH Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q949Q7|SCP29_ARATH Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana GN=SCPL29 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0WPR4|SCP34_ARATH Serine carboxypeptidase-like 34 OS=Arabidopsis thaliana GN=SCPL34 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q1PF08|SCP22_ARATH Serine carboxypeptidase-like 22 OS=Arabidopsis thaliana GN=SCPL22 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SFB5|SCP27_ARATH Serine carboxypeptidase-like 27 OS=Arabidopsis thaliana GN=SCPL27 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P55748|CBP22_HORVU Serine carboxypeptidase II-2 (Fragment) OS=Hordeum vulgare GN=CXP;2-2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P08819|CBP2_WHEAT Serine carboxypeptidase 2 OS=Triticum aestivum GN=CBP2 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 392 | ||||||
| 225458529 | 488 | PREDICTED: serine carboxypeptidase II-3- | 0.918 | 0.737 | 0.743 | 1e-160 | |
| 302142365 | 1017 | unnamed protein product [Vitis vinifera] | 0.918 | 0.353 | 0.743 | 1e-160 | |
| 356552178 | 495 | PREDICTED: serine carboxypeptidase II-3- | 0.913 | 0.723 | 0.702 | 1e-153 | |
| 363814475 | 496 | uncharacterized protein LOC100820473 pre | 0.913 | 0.721 | 0.688 | 1e-149 | |
| 357443929 | 494 | Serine carboxypeptidase-like protein [Me | 0.918 | 0.728 | 0.668 | 1e-141 | |
| 357443925 | 497 | Serine carboxypeptidase-like protein [Me | 0.915 | 0.722 | 0.668 | 1e-141 | |
| 357462111 | 497 | Serine carboxypeptidase-like protein [Me | 0.915 | 0.722 | 0.665 | 1e-140 | |
| 356547861 | 433 | PREDICTED: serine carboxypeptidase II-3- | 0.918 | 0.831 | 0.659 | 1e-140 | |
| 357443919 | 495 | Serine carboxypeptidase II-3 [Medicago t | 0.918 | 0.727 | 0.669 | 1e-139 | |
| 357443923 | 495 | Serine carboxypeptidase-like protein [Me | 0.918 | 0.727 | 0.666 | 1e-139 |
| >gi|225458529|ref|XP_002282331.1| PREDICTED: serine carboxypeptidase II-3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 570 bits (1468), Expect = e-160, Method: Compositional matrix adjust.
Identities = 269/362 (74%), Positives = 304/362 (83%), Gaps = 2/362 (0%)
Query: 33 LSGGPGCSSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTS 92
L+GGPGCSSLGYGAMEELGPFRVN DGKTL+RNEYAWNNV+NV+FLE+PAGVGFSYSNTS
Sbjct: 127 LNGGPGCSSLGYGAMEELGPFRVNPDGKTLFRNEYAWNNVSNVIFLESPAGVGFSYSNTS 186
Query: 93 SDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKN--T 150
SDY N GD TAEDSYTFL+NW ERFPQYK RDFFITGESY+GHYVPQLAYTILS N T
Sbjct: 187 SDYVNVGDKKTAEDSYTFLINWLERFPQYKTRDFFITGESYSGHYVPQLAYTILSNNNKT 246
Query: 151 SKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCD 210
++T+INLKGIAIGNAWIDDN KG++D+ WTHAL+SDE+NA I KYCDF TG ST C
Sbjct: 247 NQTVINLKGIAIGNAWIDDNTSLKGIYDYIWTHALSSDESNAGIQKYCDFTTGNFSTKCL 306
Query: 211 QYQTQGVREYGQIDLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAAL 270
Y Q E G ID+YN+YAPLC SS P + G + ++DPCSD YV SYLNLAEVQ AL
Sbjct: 307 DYTYQAEGEVGNIDIYNIYAPLCHSSGPTSRSVGSVNDFDPCSDYYVESYLNLAEVQKAL 366
Query: 271 HAKHTNWSTCSDLTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALN 330
HA++T W CS + WTDSP+T+LPTI+QL+ASGI VWIYSGDTDGRVPVTSSRYSIN
Sbjct: 367 HARNTTWGACSGVGWTDSPTTILPTIKQLMASGISVWIYSGDTDGRVPVTSSRYSINTFK 426
Query: 331 LPVETAWYPWYADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKLPP 390
LPV+TAW PWY + EVGGYV+ YKGV+F TVRGAGHLVP+YQP RAL MI+SFL+G LPP
Sbjct: 427 LPVKTAWRPWYYNKEVGGYVVEYKGVVFATVRGAGHLVPSYQPGRALTMIASFLQGTLPP 486
Query: 391 SS 392
S
Sbjct: 487 PS 488
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|302142365|emb|CBI19568.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356552178|ref|XP_003544446.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|363814475|ref|NP_001242872.1| uncharacterized protein LOC100820473 precursor [Glycine max] gi|255636975|gb|ACU18820.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357443929|ref|XP_003592242.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|357462115|ref|XP_003601339.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355481290|gb|AES62493.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355490387|gb|AES71590.1| Serine carboxypeptidase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357443925|ref|XP_003592240.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355481288|gb|AES62491.1| Serine carboxypeptidase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357462111|ref|XP_003601337.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355490385|gb|AES71588.1| Serine carboxypeptidase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356547861|ref|XP_003542323.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357443919|ref|XP_003592237.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|357462105|ref|XP_003601334.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|355481285|gb|AES62488.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|355490382|gb|AES71585.1| Serine carboxypeptidase II-3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357443923|ref|XP_003592239.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|357462109|ref|XP_003601336.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355481287|gb|AES62490.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355490384|gb|AES71587.1| Serine carboxypeptidase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 392 | ||||||
| TAIR|locus:2087368 | 502 | scpl40 "serine carboxypeptidas | 0.943 | 0.737 | 0.566 | 1.8e-112 | |
| TAIR|locus:2118706 | 465 | BRS1 "BRI1 SUPPRESSOR 1" [Arab | 0.647 | 0.546 | 0.483 | 4.3e-111 | |
| TAIR|locus:2061436 | 464 | scpl22 "serine carboxypeptidas | 0.647 | 0.547 | 0.446 | 1.1e-103 | |
| TAIR|locus:2039275 | 452 | scpl26 "serine carboxypeptidas | 0.938 | 0.814 | 0.494 | 1.9e-99 | |
| TAIR|locus:2008480 | 463 | SCPL32 "serine carboxypeptidas | 0.612 | 0.518 | 0.484 | 1.6e-98 | |
| TAIR|locus:2166870 | 499 | SCPL34 "serine carboxypeptidas | 0.512 | 0.402 | 0.536 | 5.3e-98 | |
| TAIR|locus:2077422 | 459 | SCPL27 "serine carboxypeptidas | 0.913 | 0.779 | 0.504 | 3.7e-96 | |
| TAIR|locus:2078598 | 473 | scpl25 "serine carboxypeptidas | 0.522 | 0.433 | 0.516 | 4.2e-96 | |
| TAIR|locus:2086137 | 478 | scpl33 "serine carboxypeptidas | 0.543 | 0.445 | 0.502 | 3.8e-91 | |
| TAIR|locus:2181504 | 480 | scpl35 "serine carboxypeptidas | 0.581 | 0.475 | 0.45 | 1.7e-90 |
| TAIR|locus:2087368 scpl40 "serine carboxypeptidase-like 40" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1110 (395.8 bits), Expect = 1.8e-112, P = 1.8e-112
Identities = 218/385 (56%), Positives = 269/385 (69%)
Query: 21 STSWDSPSTQTKLSGGPGCSSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLET 80
S S DS L+GGPGCSSL YGA++ELGPFRV+SDGKTL+RN YAWNN ANVLFLE+
Sbjct: 118 SKSKDSSPLLLWLNGGPGCSSLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLES 177
Query: 81 PAGVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQ 140
PAGVGFSY+NT+SD GD NTA D+Y FLVNW ERFP+YK RD +I GESYAGHYVPQ
Sbjct: 178 PAGVGFSYTNTTSDLEKHGDRNTAADNYIFLVNWLERFPEYKGRDLYIAGESYAGHYVPQ 237
Query: 141 LAYTILSKNTSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDF 200
LA+TIL + S NLKGI IGNA I+D GM+DFF +HAL S+++ A + CD
Sbjct: 238 LAHTILLHHRS--FFNLKGILIGNAVINDETDLMGMYDFFESHALISEDSLARLKSNCDL 295
Query: 201 ATGQLST---SCDQYQTQGVREYGQIDLYNVYAPLC-KSSAPPPPTAGV-IREYDPCSDK 255
T S C Q + +D+YN+YAPLC S+ P G IRE+DPCSD
Sbjct: 296 KTESASVMTEECAVVSDQIDMDTYYLDIYNIYAPLCLNSTLTRRPKRGTTIREFDPCSDH 355
Query: 256 YVNSYLNLAEVQAALHAKHTN----WSTCSDLT--WTDSPSTVLPTIQQLIASGIRVWIY 309
YV +YLN EVQAALHA T W CS + W DSP+TV+P I++L+ G+RVW++
Sbjct: 356 YVQAYLNRPEVQAALHANATKLPYEWQPCSSVIKKWNDSPTTVIPLIKELMGQGVRVWVF 415
Query: 310 SGDTDGRVPVTSSRYSINALNLPVETAWYPWYADGEVGGYVLGYKGVI-FTTVRGAGHLV 368
SGDTDGR+PVTS++YS+ +NL +TAW+PWY GEVGGY YKG + F TVRGAGH V
Sbjct: 416 SGDTDGRIPVTSTKYSLKKMNLTAKTAWHPWYLGGEVGGYTEEYKGKLTFATVRGAGHQV 475
Query: 369 PTYQPQRALIMISSFL-EGKLPPSS 392
P++QP+R+L + FL + LP +S
Sbjct: 476 PSFQPKRSLSLFIHFLNDTPLPDTS 500
|
|
| TAIR|locus:2118706 BRS1 "BRI1 SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061436 scpl22 "serine carboxypeptidase-like 22" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039275 scpl26 "serine carboxypeptidase-like 26" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008480 SCPL32 "serine carboxypeptidase-like 32" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166870 SCPL34 "serine carboxypeptidase-like 34" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2077422 SCPL27 "serine carboxypeptidase-like 27" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2078598 scpl25 "serine carboxypeptidase-like 25" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086137 scpl33 "serine carboxypeptidase-like 33" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2181504 scpl35 "serine carboxypeptidase-like 35" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q0WRX3 | SCP40_ARATH | 3, ., 4, ., 1, 6, ., - | 0.5584 | 0.9438 | 0.7370 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.16 | 0.921 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00014760001 | SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (988 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 392 | |||
| pfam00450 | 415 | pfam00450, Peptidase_S10, Serine carboxypeptidase | 1e-154 | |
| COG2939 | 498 | COG2939, COG2939, Carboxypeptidase C (cathepsin A) | 5e-46 | |
| PLN03016 | 433 | PLN03016, PLN03016, sinapoylglucose-malate O-sinap | 2e-38 | |
| PTZ00472 | 462 | PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) | 6e-33 | |
| PLN02213 | 319 | PLN02213, PLN02213, sinapoylglucose-malate O-sinap | 2e-29 | |
| PLN02209 | 437 | PLN02209, PLN02209, serine carboxypeptidase | 1e-28 | |
| PTZ00472 | 462 | PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) | 3e-10 |
| >gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase | Back alignment and domain information |
|---|
Score = 441 bits (1137), Expect = e-154
Identities = 168/373 (45%), Positives = 211/373 (56%), Gaps = 22/373 (5%)
Query: 33 LSGGPGCSSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTS 92
L+GGPGCSSLG G EELGPFRVNS G TLY N Y+WN VANVLFL+ P GVGFSYSNT+
Sbjct: 46 LNGGPGCSSLG-GLFEELGPFRVNS-GPTLYLNPYSWNKVANVLFLDQPVGVGFSYSNTT 103
Query: 93 SDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKN--T 150
SDY D TA+D+Y FL +FE+FP+YKN F+I GESYAGHYVP LA IL N
Sbjct: 104 SDY-KTDDEETAKDNYEFLQKFFEKFPEYKNNPFYIAGESYAGHYVPALAQEILDGNKKG 162
Query: 151 SKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATG---QLST 207
+ INLKG+ IGN D + F + H L SDE ++ K C +T
Sbjct: 163 TGPNINLKGVLIGNGLTDPAIQYNSYIPFAYYHGLISDELYESLKKACCGKYPDCDPANT 222
Query: 208 SCDQYQTQGVRE---YGQIDLYNVYAPLCKSSAPP--PPTAGVIREYDPCSDKYVNSYLN 262
C + G I+ YN+Y P C +S+ P + YD + YV YLN
Sbjct: 223 KCLNLVEEASGCNAYNGGINPYNIYTPCCYNSSLSLNPSSTDSCGGYDCYDESYVEKYLN 282
Query: 263 LAEVQAALHAKHT---NWSTCSD----LTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDG 315
+V+ ALHA WS C+D D ++LP + +L+ G+RV IYSGD D
Sbjct: 283 RPDVRKALHANKGSVGEWSRCNDEVFNWYGDDISKSMLPILPKLLEGGLRVLIYSGDHDL 342
Query: 316 RVPVTSSRYSINALNLPVETAWYPWY--ADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQP 373
++ I+ALN + + PWY DG+V GYV Y + F TV+GAGH+VP QP
Sbjct: 343 ICNFLGTQAWIDALNWSGKDGFRPWYVSVDGQVAGYVKSYGNLTFATVKGAGHMVPEDQP 402
Query: 374 QRALIMISSFLEG 386
+ AL M FL G
Sbjct: 403 EAALQMFKRFLSG 415
|
Length = 415 |
| >gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase | Back alignment and domain information |
|---|
| >gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase | Back alignment and domain information |
|---|
| >gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 392 | |||
| KOG1282 | 454 | consensus Serine carboxypeptidases (lysosomal cath | 100.0 | |
| PLN02209 | 437 | serine carboxypeptidase | 100.0 | |
| PF00450 | 415 | Peptidase_S10: Serine carboxypeptidase; InterPro: | 100.0 | |
| PLN03016 | 433 | sinapoylglucose-malate O-sinapoyltransferase | 100.0 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 100.0 | |
| PLN02213 | 319 | sinapoylglucose-malate O-sinapoyltransferase/ carb | 100.0 | |
| COG2939 | 498 | Carboxypeptidase C (cathepsin A) [Amino acid trans | 100.0 | |
| KOG1283 | 414 | consensus Serine carboxypeptidases [Posttranslatio | 100.0 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 99.37 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 99.35 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 99.32 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 99.32 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 99.28 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 99.27 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 99.22 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 99.22 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 99.22 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 99.19 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 99.15 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 99.14 | |
| KOG4409 | 365 | consensus Predicted hydrolase/acyltransferase (alp | 99.12 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 99.11 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 99.1 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 99.08 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 99.06 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 99.05 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 99.04 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 99.03 | |
| PLN02578 | 354 | hydrolase | 99.01 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 98.98 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 98.94 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 98.94 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 98.93 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 98.9 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 98.86 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 98.84 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 98.82 | |
| PRK07581 | 339 | hypothetical protein; Validated | 98.77 | |
| PLN02965 | 255 | Probable pheophorbidase | 98.76 | |
| KOG4178 | 322 | consensus Soluble epoxide hydrolase [Lipid transpo | 98.74 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 98.74 | |
| COG1506 | 620 | DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept | 98.71 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 98.69 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 98.69 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 98.64 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 98.59 | |
| PLN02511 | 388 | hydrolase | 98.57 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 98.55 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 98.52 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 98.5 | |
| KOG1454 | 326 | consensus Predicted hydrolase/acyltransferase (alp | 98.39 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 98.36 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 98.32 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 98.3 | |
| PRK10566 | 249 | esterase; Provisional | 98.29 | |
| PLN02872 | 395 | triacylglycerol lipase | 98.21 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 98.2 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 98.09 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 98.06 | |
| KOG1455 | 313 | consensus Lysophospholipase [Lipid transport and m | 98.04 | |
| PRK10115 | 686 | protease 2; Provisional | 98.03 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 98.02 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 98.0 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 97.94 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 97.76 | |
| PF10340 | 374 | DUF2424: Protein of unknown function (DUF2424); In | 97.73 | |
| KOG2564 | 343 | consensus Predicted acetyltransferases and hydrola | 97.71 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 97.66 | |
| KOG2100 | 755 | consensus Dipeptidyl aminopeptidase [Posttranslati | 97.54 | |
| KOG2382 | 315 | consensus Predicted alpha/beta hydrolase [General | 97.46 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 97.34 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 97.27 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 97.25 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 97.16 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 97.1 | |
| PRK05371 | 767 | x-prolyl-dipeptidyl aminopeptidase; Provisional | 97.09 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 97.0 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 96.97 | |
| PF03583 | 290 | LIP: Secretory lipase ; InterPro: IPR005152 This e | 96.83 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 96.76 | |
| KOG1552 | 258 | consensus Predicted alpha/beta hydrolase [General | 96.76 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 96.73 | |
| PLN00021 | 313 | chlorophyllase | 96.72 | |
| PF08386 | 103 | Abhydrolase_4: TAP-like protein; InterPro: IPR0135 | 96.64 | |
| COG0400 | 207 | Predicted esterase [General function prediction on | 96.57 | |
| PF03096 | 283 | Ndr: Ndr family; InterPro: IPR004142 This family c | 96.53 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 96.52 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 96.39 | |
| TIGR00976 | 550 | /NonD putative hydrolase, CocE/NonD family. This m | 96.38 | |
| KOG4391 | 300 | consensus Predicted alpha/beta hydrolase BEM46 [Ge | 95.9 | |
| PF06500 | 411 | DUF1100: Alpha/beta hydrolase of unknown function | 95.74 | |
| PF07519 | 474 | Tannase: Tannase and feruloyl esterase; InterPro: | 95.68 | |
| KOG1515 | 336 | consensus Arylacetamide deacetylase [Defense mecha | 95.68 | |
| COG3509 | 312 | LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda | 95.57 | |
| PF10503 | 220 | Esterase_phd: Esterase PHB depolymerase | 95.39 | |
| KOG2931 | 326 | consensus Differentiation-related gene 1 protein ( | 95.32 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 95.22 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 94.56 | |
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 94.25 | |
| KOG1838 | 409 | consensus Alpha/beta hydrolase [General function p | 94.18 | |
| cd00312 | 493 | Esterase_lipase Esterases and lipases (includes fu | 93.1 | |
| KOG3975 | 301 | consensus Uncharacterized conserved protein [Funct | 92.91 | |
| KOG2183 | 492 | consensus Prolylcarboxypeptidase (angiotensinase C | 92.67 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 92.28 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 92.27 | |
| KOG4667 | 269 | consensus Predicted esterase [Lipid transport and | 92.04 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 91.92 | |
| PF02129 | 272 | Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam | 91.54 | |
| PLN02454 | 414 | triacylglycerol lipase | 91.22 | |
| PF11144 | 403 | DUF2920: Protein of unknown function (DUF2920); In | 90.94 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 90.69 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 90.41 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 89.61 | |
| KOG2281 | 867 | consensus Dipeptidyl aminopeptidases/acylaminoacyl | 89.09 | |
| PF05990 | 233 | DUF900: Alpha/beta hydrolase of unknown function ( | 88.36 | |
| PF11288 | 207 | DUF3089: Protein of unknown function (DUF3089); In | 88.3 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 88.15 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 88.1 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 87.84 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 87.46 | |
| PF05577 | 434 | Peptidase_S28: Serine carboxypeptidase S28; InterP | 87.46 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 87.29 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 87.11 | |
| PF05677 | 365 | DUF818: Chlamydia CHLPS protein (DUF818); InterPro | 85.98 | |
| PLN02571 | 413 | triacylglycerol lipase | 85.27 | |
| KOG2984 | 277 | consensus Predicted hydrolase [General function pr | 85.23 | |
| COG4099 | 387 | Predicted peptidase [General function prediction o | 84.11 | |
| PF06057 | 192 | VirJ: Bacterial virulence protein (VirJ); InterPro | 84.08 | |
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 82.64 | |
| PF06342 | 297 | DUF1057: Alpha/beta hydrolase of unknown function | 81.85 | |
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 81.73 | |
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 81.35 | |
| PRK04940 | 180 | hypothetical protein; Provisional | 81.04 |
| >KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.8e-106 Score=785.26 Aligned_cols=379 Identities=48% Similarity=0.857 Sum_probs=343.9
Q ss_pred cccccccccccccccCCCC-CCCCCCeEEEecCCCChhhhhhhhhhhcCCcEEcCCCCccccCCCCCCCCCcEEEEECCC
Q 016292 4 ATATSTWLGGVKCELLPST-SWDSPSTQTKLSGGPGCSSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPA 82 (392)
Q Consensus 4 ~~~~~~~~~~~~~~~~~~~-~~~~~PlilWlnGGPG~SS~~~g~f~E~GP~~~~~~~~~l~~n~~sW~~~anvl~iDqP~ 82 (392)
...+++| ||+++ +|+++||||||||||||||++ |+|.|+|||+++.||++|..|||||||.||||||||||
T Consensus 56 ~~~LFYw-------f~eS~~~P~~dPlvLWLnGGPGCSSl~-G~~~E~GPf~v~~~G~tL~~N~ySWnk~aNiLfLd~Pv 127 (454)
T KOG1282|consen 56 GRQLFYW-------FFESENNPETDPLVLWLNGGPGCSSLG-GLFEENGPFRVKYNGKTLYLNPYSWNKEANILFLDQPV 127 (454)
T ss_pred CceEEEE-------EEEccCCCCCCCEEEEeCCCCCccchh-hhhhhcCCeEEcCCCCcceeCCccccccccEEEEecCC
Confidence 4578899 99985 488999999999999999995 99999999999999999999999999999999999999
Q ss_pred CcccccccCCCCCCCCCCCcchHHHHHHHHHHHHhCCCCCCCCEEEEccccCccchHHHHHHHHHhcC--CCceeeeeee
Q 016292 83 GVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNT--SKTIINLKGI 160 (392)
Q Consensus 83 GtGfS~~~~~~~~~~~~~~~~a~d~~~fL~~f~~~~p~~~~~~~~i~GESYgG~yvp~lA~~i~~~n~--~~~~inLkGi 160 (392)
||||||+++..++.+ +|+.+|+|+++||++||++||||++|+|||+||||||||||+||++|++.|+ ..+.|||||+
T Consensus 128 GvGFSYs~~~~~~~~-~D~~~A~d~~~FL~~wf~kfPey~~~~fyI~GESYAG~YVP~La~~I~~~N~~~~~~~iNLkG~ 206 (454)
T KOG1282|consen 128 GVGFSYSNTSSDYKT-GDDGTAKDNYEFLQKWFEKFPEYKSNDFYIAGESYAGHYVPALAQEILKGNKKCCKPNINLKGY 206 (454)
T ss_pred cCCccccCCCCcCcC-CcHHHHHHHHHHHHHHHHhChhhcCCCeEEecccccceehHHHHHHHHhccccccCCcccceEE
Confidence 999999998887764 9999999999999999999999999999999999999999999999999997 4678999999
Q ss_pred EecCCCcChhhhchhhHHHHhhcCCCCHHHHHHHHhhccccC------CCCChhHHHHHHHHH-HhhCCCcccccccccc
Q 016292 161 AIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFAT------GQLSTSCDQYQTQGV-REYGQIDLYNVYAPLC 233 (392)
Q Consensus 161 ~igng~idp~~~~~~~~~~~~~~gli~~~~~~~~~~~c~~~~------~~~~~~c~~~~~~~~-~~~~~~n~Ydi~~~~c 233 (392)
+||||++|+..+..++.+|++.||+|+++.++.+++.|.... ...+..|..+.+.+. ...++++.|+++.+.|
T Consensus 207 ~IGNg~td~~~~~~~~~~~a~~h~liSde~~~~l~~~C~~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~i~~y~i~~~~C 286 (454)
T KOG1282|consen 207 AIGNGLTDPEIDYNGRIPFAWGHGLISDELYESLKRACDFSSDNYANVDPSNTKCNKAVEEFDSKTTGDIDNYYILTPDC 286 (454)
T ss_pred EecCcccCccccccchhhhhhhcccCCHHHHHHHHHHhccCcccccccCCchhHHHHHHHHHHHHHhccCchhhhcchhh
Confidence 999999999999999999999999999999999999998742 133668999998888 5557899999999999
Q ss_pred CCCCCCCCCCCCcccCCCCChhHHhhhcChHHHHHHhcCCCCC---ccccCccc---ccCCCCChHHHHHHHHhcC-ceE
Q 016292 234 KSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTN---WSTCSDLT---WTDSPSTVLPTIQQLIASG-IRV 306 (392)
Q Consensus 234 ~~~~~~~~~~~~~~~~~~c~~~~~~~ylN~~~V~~aL~v~~~~---w~~cs~~v---~~d~~~~~~~~l~~LL~~~-irV 306 (392)
...............+++|.....++|||+++||+||||+... |+.||..| |.+...+|++.+..++.++ +||
T Consensus 287 ~~~~~~~~~~~~~~~~~~c~~~~~~~ylN~~~VrkALh~~~~~~~~W~~Cn~~v~~~~~~~~~sm~p~~~~~~~~~~~rv 366 (454)
T KOG1282|consen 287 YPTSYELKKPTDCYGYDPCLSDYAEKYLNRPEVRKALHANKTSIGKWERCNDEVNYNYNDDIKSMLPIHKKLIASGGYRV 366 (454)
T ss_pred ccccccccccccccccCCchhhhHHHhcCCHHHHHHhCCCCCCCCcccccChhhhcccccCccchHHHHHHHhhcCceEE
Confidence 8521000000113456899887779999999999999998763 99999998 5689999999999999865 999
Q ss_pred EEEecCCccccCchhHHHHHHhcCCCCccccccceeC-CeeeeEEEEEcCEEEEEEcCCcccccCCChHHHHHHHHHHHc
Q 016292 307 WIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYAD-GEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLE 385 (392)
Q Consensus 307 Liy~Gd~D~i~~~~g~~~~~~~L~w~~~~~~~~w~~~-~~~~G~~k~~~~Ltf~~V~~AGHmvp~dqP~~a~~~i~~fl~ 385 (392)
|||+||.|++||+.|+++|+++|+++...+|+||+++ +|+|||+++|++|+|++|+|||||||.|||++|++||++||.
T Consensus 367 liysGD~D~~~p~~gt~~~i~~L~~~~~~~~~pW~~~~~qvaG~~~~Y~~ltf~tVrGaGH~VP~~~p~~al~m~~~fl~ 446 (454)
T KOG1282|consen 367 LIYSGDHDLVVPFLGTQAWIKSLNLSITDEWRPWYHKGGQVAGYTKTYGGLTFATVRGAGHMVPYDKPESALIMFQRFLN 446 (454)
T ss_pred EEEeCCcceeCcchhhHHHHHhccCccccCccCCccCCCceeeeEEEecCEEEEEEeCCcccCCCCCcHHHHHHHHHHHc
Confidence 9999999999999999999999999999999999996 899999999999999999999999999999999999999999
Q ss_pred CCCCCC
Q 016292 386 GKLPPS 391 (392)
Q Consensus 386 ~~~~~~ 391 (392)
|+++|+
T Consensus 447 g~~l~~ 452 (454)
T KOG1282|consen 447 GQPLPS 452 (454)
T ss_pred CCCCCC
Confidence 999986
|
|
| >PLN02209 serine carboxypeptidase | Back alignment and domain information |
|---|
| >PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PLN03016 sinapoylglucose-malate O-sinapoyltransferase | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase | Back alignment and domain information |
|---|
| >COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters | Back alignment and domain information |
|---|
| >KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG0400 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR00976 /NonD putative hydrolase, CocE/NonD family | Back alignment and domain information |
|---|
| >KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] | Back alignment and domain information |
|---|
| >PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] | Back alignment and domain information |
|---|
| >PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] | Back alignment and domain information |
|---|
| >KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF10503 Esterase_phd: Esterase PHB depolymerase | Back alignment and domain information |
|---|
| >KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG1838 consensus Alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc | Back alignment and domain information |
|---|
| >KOG3975 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >KOG4667 consensus Predicted esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] | Back alignment and domain information |
|---|
| >PLN02454 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins | Back alignment and domain information |
|---|
| >PLN02571 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG2984 consensus Predicted hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4099 Predicted peptidase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >PRK04940 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 392 | ||||
| 1bcr_A | 263 | Complex Of The Wheat Serine Carboxypeptidase, Cpdw- | 5e-57 | ||
| 1wht_A | 256 | Structure Of The Complex Of L-Benzylsuccinate With | 7e-57 | ||
| 1whs_A | 255 | Structure Of The Complex Of L-Benzylsuccinate With | 7e-57 | ||
| 3sc2_A | 259 | Refined Atomic Model Of Wheat Serine Carboxypeptida | 8e-57 | ||
| 1gxs_A | 270 | Crystal Structure Of Hydroxynitrile Lyase From Sorg | 9e-51 | ||
| 1ivy_A | 452 | Physiological Dimer Hpp Precursor Length = 452 | 4e-43 | ||
| 1bcr_B | 160 | Complex Of The Wheat Serine Carboxypeptidase, Cpdw- | 4e-41 | ||
| 1wht_B | 153 | Structure Of The Complex Of L-Benzylsuccinate With | 6e-41 | ||
| 3sc2_B | 152 | Refined Atomic Model Of Wheat Serine Carboxypeptida | 6e-41 | ||
| 1whs_B | 153 | Structure Of The Complex Of L-Benzylsuccinate With | 6e-41 | ||
| 1gxs_B | 158 | Crystal Structure Of Hydroxynitrile Lyase From Sorg | 5e-35 | ||
| 4az0_A | 300 | Crystal Structure Of Cathepsin A, Complexed With 8a | 4e-31 | ||
| 1ac5_A | 483 | Crystal Structure Of Kex1(delta)p, A Prohormone-pro | 1e-27 | ||
| 1wpx_A | 421 | Crystal Structure Of Carboxypeptidase Y Inhibitor C | 1e-26 | ||
| 1cpy_A | 421 | Site-Directed Mutagenesis On (Serine) Carboxypeptid | 3e-25 | ||
| 4az0_B | 155 | Crystal Structure Of Cathepsin A, Complexed With 8a | 5e-10 |
| >pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 | Back alignment and structure |
|
| >pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 | Back alignment and structure |
| >pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 | Back alignment and structure |
| >pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 | Back alignment and structure |
| >pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 | Back alignment and structure |
| >pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 | Back alignment and structure |
| >pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 160 | Back alignment and structure |
| >pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 | Back alignment and structure |
| >pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 152 | Back alignment and structure |
| >pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 | Back alignment and structure |
| >pdb|1GXS|B Chain B, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 158 | Back alignment and structure |
| >pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 | Back alignment and structure |
| >pdb|1AC5|A Chain A, Crystal Structure Of Kex1(delta)p, A Prohormone-processing Carboxypeptidase From Saccharomyces Cerevisiae Length = 483 | Back alignment and structure |
| >pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 | Back alignment and structure |
| >pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 | Back alignment and structure |
| >pdb|4AZ0|B Chain B, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 155 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 | Back alignment and structure |
|---|
Score = 434 bits (1119), Expect = e-151
Identities = 94/404 (23%), Positives = 158/404 (39%), Gaps = 48/404 (11%)
Query: 33 LSGGPGCSSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTS 92
L+GGPGCSS+ GA+ E GPFRVNSDGK LY NE +W + ++LF++ P G GFS
Sbjct: 73 LNGGPGCSSMD-GALVESGPFRVNSDGK-LYLNEGSWISKGDLLFIDQPTGTGFSVEQNK 130
Query: 93 SDYSNPGDN------NTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTIL 146
+ + + + FL N+F+ FP+ R ++GESYAG Y+P A IL
Sbjct: 131 DEGKIDKNKFDEDLEDVTKHFMDFLENYFKIFPEDLTRKIILSGESYAGQYIPFFANAIL 190
Query: 147 SKN----TSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDE--TNAAINKYCDF 200
+ N +LK + IGN WID N + F L + + +
Sbjct: 191 NHNKFSKIDGDTYDLKALLIGNGWIDPNTQSLSYLPFAMEKKLIDESNPNFKHLTNAHEN 250
Query: 201 ATGQLSTSCDQYQTQGVREYGQIDLYNVYAPLCKSSAPPPPTAGV-------------IR 247
++ S + ++ N+ + S+ +
Sbjct: 251 CQNLIN-SASTDEAAHFSYQECENILNLLLSYTRESSQKGTADCLNMYNFNLKDSYPSCG 309
Query: 248 EYDPCSDKYVNSYLNLAEVQAALHA---KHTNWSTCSDL----TWTDSPSTVLPTIQQLI 300
P +V+ + + V +LH K +W C++ + + L+
Sbjct: 310 MNWPKDISFVSKFFSTPGVIDSLHLDSDKIDHWKECTNSVGTKLSNPISKPSIHLLPGLL 369
Query: 301 ASGIRVWIYSGDTDGRVPVTSSRYSINALNLP------VETAWYPWYA-------DGEVG 347
SGI + +++GD D +I+ L + + W E
Sbjct: 370 ESGIEIVLFNGDKDLICNNKGVLDTIDNLKWGGIKGFSDDAVSFDWIHKSKSTDDSEEFS 429
Query: 348 GYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKLPPS 391
GYV + + F +V A H+VP + + ++ + +
Sbjct: 430 GYVKYDRNLTFVSVYNASHMVPFDKSLVSRGIVDIYSNDVMIID 473
|
| >1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 | Back alignment and structure |
|---|
| >1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 | Back alignment and structure |
|---|
| >1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 | Back alignment and structure |
|---|
| >1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 | Back alignment and structure |
|---|
| >1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 | Back alignment and structure |
|---|
| >1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 392 | |||
| 1ivy_A | 452 | Human protective protein; carboxypeptidase, serine | 100.0 | |
| 1cpy_A | 421 | Serine carboxypeptidase; hydrolase (carboxypeptida | 100.0 | |
| 1ac5_A | 483 | KEX1(delta)P; carboxypeptidase, hydrolase, glycopr | 100.0 | |
| 4az3_A | 300 | Lysosomal protective protein 32 kDa chain; hydrola | 100.0 | |
| 1whs_A | 255 | Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T | 100.0 | |
| 1gxs_A | 270 | P-(S)-hydroxymandelonitrIle lyase chain A; inhibit | 100.0 | |
| 1whs_B | 153 | Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T | 100.0 | |
| 1gxs_B | 158 | P-(S)-hydroxymandelonitrIle lyase chain B; inhibit | 100.0 | |
| 4az3_B | 155 | Lysosomal protective protein 20 kDa chain; hydrola | 100.0 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 99.41 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 99.4 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 99.38 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 99.36 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 99.35 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 99.32 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 99.32 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 99.31 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 99.31 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 99.3 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 99.3 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 99.3 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 99.29 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 99.29 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 99.29 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 99.28 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 99.27 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 99.27 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 99.27 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 99.26 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 99.26 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 99.26 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 99.26 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 99.25 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 99.25 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 99.24 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 99.23 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 99.23 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 99.22 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 99.22 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 99.22 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 99.22 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 99.21 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 99.21 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 99.21 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 99.21 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 99.2 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 99.19 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 99.18 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 99.18 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 99.17 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 99.15 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 99.15 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 99.14 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 99.14 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 99.13 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 99.13 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 99.12 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 99.12 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 99.12 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 99.12 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 99.11 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 99.09 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 99.09 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 99.08 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 99.08 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 99.08 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 99.07 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 99.06 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 99.05 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 99.05 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 99.05 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 99.05 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 99.03 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 99.03 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 99.03 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 98.6 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 99.02 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 99.02 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 99.0 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 98.99 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 98.99 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 98.96 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 98.96 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 98.95 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 98.95 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 98.95 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 98.95 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 98.95 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 98.93 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 98.93 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 98.93 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 98.93 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 98.92 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 98.9 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 98.9 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 98.89 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 98.89 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 98.88 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 98.87 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 98.85 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 98.85 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 98.84 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 98.83 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 98.83 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 98.82 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 98.82 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 98.82 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 98.81 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 98.81 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 98.79 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 98.79 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.79 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.78 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 98.77 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 98.77 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 98.77 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 98.76 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 98.76 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 98.75 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 98.75 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 98.71 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 98.71 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 98.71 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 98.7 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 98.69 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 98.67 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 98.66 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 98.66 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 98.65 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 98.64 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 98.63 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 98.62 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 98.61 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 98.6 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 98.6 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 98.6 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 98.6 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 98.59 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 98.59 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 98.58 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 98.54 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 98.53 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 98.52 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 98.52 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 98.5 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 98.5 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 98.48 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 98.48 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 98.48 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 98.46 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 98.44 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 98.43 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 98.43 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 98.41 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 98.41 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 98.41 | |
| 2xe4_A | 751 | Oligopeptidase B; hydrolase-inhibitor complex, hyd | 98.41 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 98.39 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 98.36 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 98.36 | |
| 4hvt_A | 711 | Ritya.17583.B, post-proline cleaving enzyme; ssgci | 98.36 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 98.34 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 98.33 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 98.31 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 98.31 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 98.3 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 98.28 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 98.28 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 98.27 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 98.27 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 98.24 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 98.22 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 98.2 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 98.19 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 98.18 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 98.17 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 98.08 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 98.06 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 98.06 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 98.02 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 98.0 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 97.99 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 97.97 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 97.92 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 97.89 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 97.85 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 97.82 | |
| 3guu_A | 462 | Lipase A; protein structure, hydrolase; HET: 1PE; | 97.81 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 97.78 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 97.76 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 97.72 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 97.56 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 97.54 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 97.53 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 97.51 | |
| 1lns_A | 763 | X-prolyl dipeptidyl aminopetidase; alpha beta hydr | 97.46 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 97.36 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 97.2 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 97.16 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 97.13 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 96.94 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 96.86 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 96.74 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 96.73 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 96.59 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 96.44 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 96.43 | |
| 2ogt_A | 498 | Thermostable carboxylesterase EST50; alpha/beta hy | 96.15 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 96.13 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 96.11 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 96.09 | |
| 1qe3_A | 489 | PNB esterase, para-nitrobenzyl esterase; alpha-bet | 96.06 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 96.02 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 95.97 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 95.58 | |
| 3d59_A | 383 | Platelet-activating factor acetylhydrolase; secret | 95.46 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 95.45 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 95.34 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 95.26 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 95.16 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 95.12 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 94.95 | |
| 1ea5_A | 537 | ACHE, acetylcholinesterase; hydrolase, serine hydr | 94.9 | |
| 2ha2_A | 543 | ACHE, acetylcholinesterase; hydrolase fold, serine | 94.74 | |
| 1p0i_A | 529 | Cholinesterase; serine hydrolase, butyrate, hydrol | 94.66 | |
| 2h7c_A | 542 | Liver carboxylesterase 1; enzyme, cholesteryl este | 94.66 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 94.58 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 94.47 | |
| 3nuz_A | 398 | Putative acetyl xylan esterase; structural genomic | 94.45 | |
| 3i2k_A | 587 | Cocaine esterase; alpha/beta hydrolase, hydrolase; | 94.21 | |
| 2fj0_A | 551 | JuvenIle hormone esterase; manduca sexta, alpha-be | 93.9 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 93.85 | |
| 2d81_A | 318 | PHB depolymerase; alpha/beta hydrolase fold, circu | 93.58 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 93.43 | |
| 1mpx_A | 615 | Alpha-amino acid ester hydrolase; alpha/beta hydro | 92.56 | |
| 3iii_A | 560 | COCE/NOND family hydrolase; structural genomics, c | 92.53 | |
| 1dx4_A | 585 | ACHE, acetylcholinesterase; hydrolase, serine este | 92.28 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 92.06 | |
| 2b9v_A | 652 | Alpha-amino acid ester hydrolase; catalytic triad, | 91.75 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 91.48 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 91.35 | |
| 1ukc_A | 522 | ESTA, esterase; fungi, A/B hydrolase fold, acetylc | 91.12 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 90.92 | |
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 90.24 | |
| 1thg_A | 544 | Lipase; hydrolase(carboxylic esterase); HET: NAG N | 90.06 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 89.84 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 89.81 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 89.42 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 89.3 | |
| 1llf_A | 534 | Lipase 3; candida cylindracea cholesterol esterase | 88.54 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 88.13 | |
| 3bix_A | 574 | Neuroligin-1, neuroligin I; esterase domain, alpha | 87.08 | |
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 86.97 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 86.02 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 85.25 | |
| 2bce_A | 579 | Cholesterol esterase; hydrolase, serine esterase, | 84.72 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 84.47 | |
| 2hih_A | 431 | Lipase 46 kDa form; A1 phospholipase, phospholipid | 84.32 | |
| 4ebb_A | 472 | Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 | 83.59 | |
| 4fol_A | 299 | FGH, S-formylglutathione hydrolase; D-type esteras | 83.33 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 82.65 | |
| 3pic_A | 375 | CIP2; alpha/beta hydrolase fold, glucuronoyl ester | 82.58 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 81.18 |
| >1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-94 Score=717.60 Aligned_cols=370 Identities=33% Similarity=0.622 Sum_probs=323.0
Q ss_pred ccccccccccccccCCCCC-CCCCCeEEEecCCCChhhhhhhhhhhcCCcEEcCCCCccccCCCCCCCCCcEEEEECCCC
Q 016292 5 TATSTWLGGVKCELLPSTS-WDSPSTQTKLSGGPGCSSLGYGAMEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAG 83 (392)
Q Consensus 5 ~~~~~~~~~~~~~~~~~~~-~~~~PlilWlnGGPG~SS~~~g~f~E~GP~~~~~~~~~l~~n~~sW~~~anvl~iDqP~G 83 (392)
..+++| ||++++ |+++||+|||||||||||+ +|+|.|+|||+++.++.+++.||+||++.|||||||||+|
T Consensus 32 ~~lfy~-------f~~s~~~~~~~Pl~lwlnGGPG~Ss~-~g~~~e~GP~~~~~~~~~l~~n~~sw~~~~~~lfiDqP~G 103 (452)
T 1ivy_A 32 KHLHYW-------FVESQKDPENSPVVLWLNGGPGCSSL-DGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAG 103 (452)
T ss_dssp EEEEEE-------EECCSSCGGGSCEEEEECCTTTBCTH-HHHHTTTSSEEECTTSSCEEECTTCGGGSSEEEEECCSTT
T ss_pred CeEEEE-------EEEcCCCCCCCCEEEEECCCCcHHHH-HHHHHhcCCcEEeCCCceeeeCCCcccccccEEEEecCCC
Confidence 356777 888864 6789999999999999999 7999999999999998889999999999999999999999
Q ss_pred cccccccCCCCCCCCCCCcchHHHHHHHHHHHHhCCCCCCCCEEEEccccCccchHHHHHHHHHhcCCCceeeeeeeEec
Q 016292 84 VGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIG 163 (392)
Q Consensus 84 tGfS~~~~~~~~~~~~~~~~a~d~~~fL~~f~~~~p~~~~~~~~i~GESYgG~yvp~lA~~i~~~n~~~~~inLkGi~ig 163 (392)
|||||... ..+.+ +++++|+|+++||++||++||+|++++|||+||||||+|||.||.+|++.. ++|||||+||
T Consensus 104 tGfS~~~~-~~~~~-~~~~~a~~~~~~l~~f~~~~p~~~~~~~~i~GeSYgG~y~p~la~~i~~~~----~~~l~g~~ig 177 (452)
T 1ivy_A 104 VGFSYSDD-KFYAT-NDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDP----SMNLQGLAVG 177 (452)
T ss_dssp STTCEESS-CCCCC-BHHHHHHHHHHHHHHHHHHSGGGTTSCEEEEEETTHHHHHHHHHHHHTTCT----TSCEEEEEEE
T ss_pred CCcCCcCC-CCCcC-CcHHHHHHHHHHHHHHHHhcHHhcCCCEEEEeeccceeehHHHHHHHHhcC----ccccceEEec
Confidence 99999653 34543 677899999999999999999999999999999999999999999998643 6999999999
Q ss_pred CCCcChhhhchhhHHHHhhcCCCCHHHHHHHHhhccccC-----CCCChhHHHHHHHHHHhh--CCCccccccccccCCC
Q 016292 164 NAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFAT-----GQLSTSCDQYQTQGVREY--GQIDLYNVYAPLCKSS 236 (392)
Q Consensus 164 ng~idp~~~~~~~~~~~~~~gli~~~~~~~~~~~c~~~~-----~~~~~~c~~~~~~~~~~~--~~~n~Ydi~~~~c~~~ 236 (392)
||++||..+..++.+|++.||+|+++.++.+.+.|.... ......|..+.+.+.+.+ +++|+|||+.+ |...
T Consensus 178 n~~~d~~~~~~~~~~~~~~~glis~~~~~~~~~~c~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~~in~Y~i~~~-C~~~ 256 (452)
T 1ivy_A 178 NGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAP-CAGG 256 (452)
T ss_dssp SCCSBHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHEETTEECCSSCCCHHHHHHHHHHHHHHHSSSCCTTCTTSC-CTTC
T ss_pred CCccChhhhhhhHHHHHhhhhcCCHHHHHHHHHHhhhcccccccccchHHHHHHHHHHHHHHhcCCCcccccccc-cccc
Confidence 999999999999999999999999999999999886421 134557999888887764 78999999875 7532
Q ss_pred CCC------------------C-C--CCCC---------cccC-CCCCh-hHHhhhcChHHHHHHhcCCCC--CccccCc
Q 016292 237 APP------------------P-P--TAGV---------IREY-DPCSD-KYVNSYLNLAEVQAALHAKHT--NWSTCSD 282 (392)
Q Consensus 237 ~~~------------------~-~--~~~~---------~~~~-~~c~~-~~~~~ylN~~~V~~aL~v~~~--~w~~cs~ 282 (392)
... . . .+.. ...+ +||.+ ..+..|||+++||+||||+.. .|+.||.
T Consensus 257 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pc~~~~~~~~ylN~~~Vq~ALhv~~~~~~W~~Cs~ 336 (452)
T 1ivy_A 257 VPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNF 336 (452)
T ss_dssp CSSSEEEETTEEEECCCSCSSTTSCCCCCCGGGHHHHTCEEEECCTTCCCHHHHHHHTSHHHHHHTTCCTTSCCCCSBCH
T ss_pred cccccchhcccccccccchhhhhhhhccccccccccccccccCCCCccchHHHHHHhCcHHHHHHcCCCCCCCccccCcH
Confidence 100 0 0 0000 0112 37854 578999999999999999843 2999999
Q ss_pred cc---ccCCCCChHHHHHHHHhc-CceEEEEecCCccccCchhHHHHHHhcCCCCccccccceeC-C----eeeeEEEEE
Q 016292 283 LT---WTDSPSTVLPTIQQLIAS-GIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYAD-G----EVGGYVLGY 353 (392)
Q Consensus 283 ~v---~~d~~~~~~~~l~~LL~~-~irVLiy~Gd~D~i~~~~g~~~~~~~L~w~~~~~~~~w~~~-~----~~~G~~k~~ 353 (392)
.| |.+.+.++++.++.||++ |+|||||+||+|++||+.|+++|+++|+|++..+|++|+++ + +++||+++|
T Consensus 337 ~V~~~~~~~~~s~~~~~~~LL~~~girVlIYsGD~D~icn~~Gt~~wi~~L~~~~~~~~~pw~~~~~~~~~~vaG~~~~y 416 (452)
T 1ivy_A 337 LVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEF 416 (452)
T ss_dssp HHHHHCBCCCSBSHHHHHHHHHHTCCEEEEEEETTCSSSCHHHHHHHHHHTCCCEEEEEEEEEEECTTSCEEEEEEEEEE
T ss_pred HHHhhhhcccccHHHHHHHHHhccCceEEEEeCCCCccCCcHHHHHHHHhcCCcccccceeeeeccCCCCcccceEEEEE
Confidence 88 668889999999999998 99999999999999999999999999999999999999876 5 999999999
Q ss_pred cCEEEEEEcCCcccccCCChHHHHHHHHHHHcCCCC
Q 016292 354 KGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKLP 389 (392)
Q Consensus 354 ~~Ltf~~V~~AGHmvp~dqP~~a~~~i~~fl~~~~~ 389 (392)
+||||++|++||||||+|||++|++||++||.++++
T Consensus 417 ~nLtf~tV~gAGHmVP~dqP~~al~m~~~fl~g~~l 452 (452)
T 1ivy_A 417 SHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY 452 (452)
T ss_dssp SSEEEEEETTCCSSHHHHCHHHHHHHHHHHHTTCCC
T ss_pred cceEEEEECCCcccCcccChHHHHHHHHHHhcCCCC
Confidence 999999999999999999999999999999999875
|
| >1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* | Back alignment and structure |
|---|
| >1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* | Back alignment and structure |
|---|
| >1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* | Back alignment and structure |
|---|
| >1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* | Back alignment and structure |
|---|
| >1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 | Back alignment and structure |
|---|
| >4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
| >1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... | Back alignment and structure |
|---|
| >2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... | Back alignment and structure |
|---|
| >1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... | Back alignment and structure |
|---|
| >2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A | Back alignment and structure |
|---|
| >2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 | Back alignment and structure |
|---|
| >3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* | Back alignment and structure |
|---|
| >1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A | Back alignment and structure |
|---|
| >1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A | Back alignment and structure |
|---|
| >1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* | Back alignment and structure |
|---|
| >3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* | Back alignment and structure |
|---|
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} | Back alignment and structure |
|---|
| >2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} | Back alignment and structure |
|---|
| >4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* | Back alignment and structure |
|---|
| >4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* | Back alignment and structure |
|---|
| >3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 392 | ||||
| g1wht.1 | 409 | c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat | 1e-109 | |
| g1gxs.1 | 425 | c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So | 1e-107 | |
| d1ivya_ | 452 | c.69.1.5 (A:) Human 'protective protein', HPP {Hum | 1e-95 | |
| d1ac5a_ | 483 | c.69.1.5 (A:) Serine carboxypeptidase II {Baker's | 4e-90 | |
| d1wpxa1 | 421 | c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak | 2e-88 |
| >d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 | Back information, alignment and structure |
|---|
| >d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 | Back information, alignment and structure |
|---|
| >d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 392 | |||
| g1wht.1 | 409 | Serine carboxypeptidase II {Wheat (Triticum vulgar | 100.0 | |
| d1ivya_ | 452 | Human 'protective protein', HPP {Human (Homo sapie | 100.0 | |
| g1gxs.1 | 425 | Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T | 100.0 | |
| d1ac5a_ | 483 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 100.0 | |
| d1wpxa1 | 421 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 100.0 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 99.6 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 99.52 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.48 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 99.46 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 99.44 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 99.39 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 99.38 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 99.38 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 99.38 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 99.33 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 99.32 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.28 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 99.28 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 99.24 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 99.23 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 99.21 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 99.2 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 99.19 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 99.14 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 99.09 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 99.03 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 98.98 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 98.97 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 98.95 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 98.91 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 98.88 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 98.84 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 98.68 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 98.63 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 98.62 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 98.56 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 98.53 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 98.51 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 98.5 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 98.48 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 98.34 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 98.28 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 98.27 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 98.27 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 98.24 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 98.18 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 98.06 | |
| d1qfma2 | 280 | Prolyl oligopeptidase, C-terminal domain {Pig (Sus | 98.0 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 97.95 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 97.93 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 97.82 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 97.72 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 97.7 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 97.49 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 97.32 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 97.26 | |
| d1u4na_ | 308 | Carboxylesterase {Alicyclobacillus acidocaldarius | 97.18 | |
| d2dsta1 | 122 | Hypothetical protein TTHA1544 {Thermus thermophilu | 97.12 | |
| d1lnsa3 | 405 | X-Prolyl dipeptidyl aminopeptidase PepX, middle do | 96.76 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 96.53 | |
| d1qlwa_ | 318 | A novel bacterial esterase {Alcaligenes sp. [TaxId | 96.35 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 96.26 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 96.03 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 95.94 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 95.92 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 95.56 | |
| d1ju3a2 | 347 | Bacterial cocaine esterase N-terminal domain {Rhod | 94.92 | |
| d2vata1 | 376 | Acetyl-CoA:deacetylcephalosporin C acetyltransfera | 94.69 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 94.38 | |
| d1mpxa2 | 381 | Alpha-amino acid ester hydrolase {Xanthomonas citr | 94.38 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 94.31 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 94.24 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 93.48 | |
| d2b9va2 | 385 | Alpha-amino acid ester hydrolase {Acetobacter past | 92.96 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 92.49 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 92.44 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 92.14 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 92.03 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 91.52 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 91.35 | |
| d2d81a1 | 318 | Polyhydroxybutyrate depolymerase {Penicillium funi | 90.09 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 89.91 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 89.64 | |
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 88.35 | |
| d2gzsa1 | 265 | Enterobactin and salmochelin hydrolase IroE {Esche | 87.31 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 86.64 | |
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 86.57 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 84.67 | |
| d1pv1a_ | 299 | Hypothetical esterase YJL068C {Baker's yeast (Sacc | 83.52 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 82.82 |
| >d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} | Back information, alignment and structure |
|---|
| >d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
| >d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|