Citrus Sinensis ID: 016338


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MSVAVVPLAAKFGWSSSFLGIVQSSFLWGYIFSSVIGGALVDKYGGKKVLAWGVALWSLSTLLTPWAATHSTASLLAVRAFFGLAEGVAMPAMSTLTSRWFPSHERASAIGICMGGFHLGNVVGLLLTPIMLSTIGISGPFILFSSLGLLWLSTWTSKVTNDPCNSPFVSKSELRLIQAGKSDSVKKRNPPSLRHLLSKLPSWTVIIANITNNWGYFVLLSWMPIYFNTVFNVNLKQAAWFSAVPWGTMAVSGYMAGKASDSLIKAGYSLTLVRKIMQSIGFIGPGVSLLCLNYAKSPAVAAVLITIALSLSSFSQAGYLLNIQEIAPDCAGFLHGIANSAGTLAAIISTIGTGYFVQWLGSFQAFLTVTAGLYFVTTIFWNLYSTGERVF
cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccc
MSVAVVPLAAKFGWSSSFLGIVQSSFLWGYIFSSVIGGALVDKYGGKKVLAWGVALWSLSTLLTPWAATHSTASLLAVRAFFGLAEGVAMPAMSTLTSRWFPSHERASAIGICMGGFHLGNVVGLLLTPIMLSTIGISGPFILFSSLGLLWLSTWTSKVTNDPCNSPFVSKS*********************RHLLSKLPSWTVIIANITNNWGYFVLLSWMPIYFNTVFNVNLKQAAWFSAVPWGTMAVSGYMAGKASDSLIKAGYSLTLVRKIMQSIGFIGPGVSLLCLNYAKSPAVAAVLITIALSLSSFSQAGYLLNIQEIAPDCAGFLHGIANSAGTLAAIISTIGTGYFVQWLGSFQAFLTVTAGLYFVTTIFWNLYSTGERVF
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxHHxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVAVVPLAAKFGWSSSFLGIVQSSFLWGYIFSSVIGGALVDKYGGKKVLAWGVALWSLSTLLTPWAATHSTASLLAVRAFFGLAEGVAMPAMSTLTSRWFPSHERASAIGICMGGFHLGNVVGLLLTPIMLSTIGISGPFILFSSLGLLWLSTWTSKVTNDPCNSPFVSKSELRLIQAGKSDSVKKRNPPSLRHLLSKLPSWTVIIANITNNWGYFVLLSWMPIYFNTVFNVNLKQAAWFSAVPWGTMAVSGYMAGKASDSLIKAGYSLTLVRKIMQSIGFIGPGVSLLCLNYAKSPAVAAVLITIALSLSSFSQAGYLLNIQEIAPDCAGFLHGIANSAGTLAAIISTIGTGYFVQWLGSFQAFLTVTAGLYFVTTIFWNLYSTGERVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable anion transporter 3, chloroplastic Inorganic phosphate and probable anion transporter.probableQ7XJR2
Probable anion transporter 2, chloroplastic Probable anion transporter.probableQ53WP9
Solute carrier family 17 member 9 Involved in vesicular storage and exocytosis of ATP. May accumulate ATP and other nucleotides in secretory vesicles such as adrenal chromaffin granules and synaptic vesicles.probableQ9BYT1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:very confident
Coverage over the Query: 2-177,189-385
View the alignment between query and template
View the model in PyMOL