Citrus Sinensis ID: 016348


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MISSIKATVPTATINGSDSIFRKRLLSPTQRSLFLPPLQVDSSSKSEFSLSRPLHISNVSCFEPVRVQKSLIKCKAYEAEQSQPIEREEAKSAAAQKVKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWATRIAEPPNTDLEFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLLGETFPLPVYMSLVPIIGGCALAAVTELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQLWAAGYKTAMSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIVSSIIIFHTPVQPINALGAAIAILGTFLYSQAKQ
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccc
***********************************************************************************************QKVKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWATRIAEPPNTDLEFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLLGETFPLPVYMSLVPIIGGCALAAVTELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQLWAAGYKTAMSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIVSSIIIFHTPVQPINALGAAIAILGTFLYSQAKQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISSIKATVPTATINGSDSIFRKRLLSPTQRSLFLPPLQVDSSSKSEFSLSRPLHISNVSCFEPVRVQKSLIKCKAYEAEQSQPIEREEAKSAAAQKVKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLACGSLMMLISWATRIAEPPNTDLEFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSGEPAFSVLVSRFLLGETFPLPVYMSLVPIIGGCALAAVTELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSGMNYYACLSILSLLILTPFAIAVEGPQLWAAGYKTAMSQIGPQFIWWVAAQSIFYHLYNQVSYMSLDEISPLTFSIGNTMKRISVIVSSIIIFHTPVQPINALGAAIAILGTFLYSQAKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucose-6-phosphate/phosphate translocator 2, chloroplastic Glucose 6-phosphate (Glc6P) transporter. Transports also inorganic phosphate, 3-phosphoglycerate, triose phosphates and, to a leser extent, phosphoenolpyruvate. Responsible for the transport of Glc6P into plastids of heterotrophic tissues where it can be used as a carbon source for starch biosynthesis, as substrate for fatty acid biosynthesis or as substrate for NADPH generation via the oxidative pentose phosphate pathway (OPPP). Required for dynamic acclimation of photosynthesis.confidentQ94B38
Glucose-6-phosphate/phosphate translocator 1, chloroplastic Glucose 6-phosphate (Glc6P) transporter. Transports also inorganic phosphate, 3-phosphoglycerate, triose phosphates and, to a leser extent, phosphoenolpyruvate. Responsible for the transport of Glc6P into plastids of heterotrophic tissues where it can be used as a carbon source for starch biosynthesis, as substrate for fatty acid biosynthesis or as substrate for NADPH generation via the oxidative pentose phosphate pathway (OPPP). Required for pollen maturation and embryo sac development.probableQ9M5A9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 166-236
View the alignment between query and template
View the model in PyMOL
Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 334-389
View the alignment between query and template
View the model in PyMOL