Citrus Sinensis ID: 016355

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MVLSQQCRIKSAITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIAVGIVSSPSQGDKSPENCSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPRECLSARASSSSQSDNSCVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDEDNSEELTQSVHESEQSAWETFNSLPMIMDAYSDQERSQLALIQRFLAGGFSLSDHHPYQSPPRCTDSYGDAMKDLHQLPWLERFVSVISDTYYEDYMQ
ccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHHcccccEEccccccccccccccccccccccccccccccEEccccccccccccccccccccccHHHHccccccccHHHHHHHHHHHcccccccccccccEEEccccccEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccc
ccccHHHHHHHHEcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccEEEcccccHHccccccccHHHHHHHHHHHHHEHcccccEEEcccccccccccHHHHHHHccHHHHHHHHHHHHHHcccccccEEcccccccHEEEEccccccccccccccccccEEEEccccEEEEcccccccccccHHHHHHHHHccccccHHHHHHHHHcccccccccccccEEccccccEEEEEEccEEEEEEccccccccccEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccHHHHHHEEEcccccHHHcc
mvlsqqcrIKSAITREEKLDIPLLVALRQRILEYTSNLEAFVLKLvpsielerplRLAQIAVGivsspsqgdkspencsiccedkpypmmitmkcshkfCSHCMRtyidgkvqssqvpircpqlrCKYFIstvecksflplssyESLETALAEANilhsdriycpfpncsvlldpreclsarassssqsdnscvecpvcerficvecgvpwhsslsceeyqnlpleerdagditlHRLAQNKRWRRCQQCRRMIELthgcyhmtcwcghefcyscgaeyrdgqqtcqcafwdednseelTQSVHESEQSAWETFNSLPMIMDAYSDQERSQLALIQRFLAggfslsdhhpyqspprctdsygdamkdlhqlpwlERFVSVISDTYYEDYMQ
mvlsqqcriksaitreekldipLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIAVGIvsspsqgdkspenCSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPRECLSArassssqsdnscvECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDEDNSEELTQSVHESEQSAWETFNSLPMIMDAYSDQERSQLALIQRFLAGGFSLSDHHPYQSPPRCTDSYGDAMKDLHQLPWLERFVSVISDTYYEDYMQ
MVLSQQCRIKSAITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIAVGIVSSPSQGDKSPENCSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPRECLsarassssqsdnsCVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDEDNSEELTQSVHESEQSAWETFNSLPMIMDAYSDQERSQLALIQRFLAGGFSLSDHHPYQSPPRCTDSYGDAMKDLHQLPWLERFVSVISDTYYEDYMQ
********IKSAITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIAVGIV************CSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPRECL************SCVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWD******************WETFNSLPMIMDAYS***RSQLALIQRFLAGGFSLSDH********CTDSYGDAMKDLHQLPWLERFVSVISDTYYED***
*V*S****************IPLLVALRQRILEYTSNLEAFVLKLVPSIEL***************************SICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPRECLSARA**SSQSDNSCVECPVCERFICVECGVPWHSSLSCEEYQNLPL*****GDITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDE*********************NSLPMIMDAYSDQERS*LALIQRFLAGGFSL*********************DLHQLPWLERFVSVISDTYYEDYM*
MVLSQQCRIKSAITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIAVGIVS**********NCSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPRECL**************VECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDEDN**************AWETFNSLPMIMDAYSDQERSQLALIQRFLAGGFSLSDHHPYQSPPRCTDSYGDAMKDLHQLPWLERFVSVISDTYYEDYMQ
MVLSQQCRIKSAITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIA************SPENCSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPRECLS**ASSSSQSDNSCVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDEDNSEELTQSVHESEQSAWETFNSLPMIMDAYSDQERSQLALIQRFLAGGFSLSDHHPYQSPPRCTDSYGDAMKDLHQLPWLERFVSVISDTYYEDYMQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLSQQCRIKSAITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIAVGIVSSPSQGDKSPENCSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPRECLSARASSSSQSDNSCVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDEDNSEELTQSVHESEQSAWETFNSLPMIMDAYSDQERSQLALIQRFLAGGFSLSDHHPYQSPPRCTDSYGDAMKDLHQLPWLERFVSVISDTYYEDYMQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query391 2.2.26 [Sep-21-2011]
D3YYI7515 Probable E3 ubiquitin-pro yes no 0.483 0.366 0.296 1e-16
Q9SKC4514 Probable E3 ubiquitin-pro no no 0.662 0.503 0.259 2e-15
Q4KLT0282 Probable E3 ubiquitin-pro N/A no 0.475 0.659 0.280 5e-14
Q9SKC3 543 Probable E3 ubiquitin-pro no no 0.547 0.394 0.260 1e-13
P0CE101787 Putative uncharacterized no no 0.429 0.094 0.255 3e-12
O76924509 Protein ariadne-2 OS=Dros yes no 0.624 0.479 0.226 5e-12
Q9P3U4504 Uncharacterized RING fing yes no 0.621 0.482 0.272 6e-12
Q8TC41275 Probable E3 ubiquitin-pro yes no 0.406 0.578 0.299 1e-11
P36113551 RING finger protein YKR01 yes no 0.575 0.408 0.262 6e-11
Q7Z419303 E3 ubiquitin-protein liga no no 0.526 0.679 0.272 7e-11
>sp|D3YYI7|RN217_MOUSE Probable E3 ubiquitin-protein ligase RNF217 OS=Mus musculus GN=Rnf217 PE=3 SV=2 Back     alignment and function desciption
 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 89/209 (42%), Gaps = 20/209 (9%)

Query: 78  CSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKS 137
           C +C EDKP   +    C    C  C++ Y+  +VQ  QV I+CP   C  F+       
Sbjct: 236 CRVCLEDKPIKPLPC--CKKAVCEECLKIYLSSQVQLGQVEIKCPVTECFEFLEETTVVY 293

Query: 138 FLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPRECLSARASSSSQSDNSCVECP 197
            L        +  L    I  S +   P P C      ++       S S+S    ++CP
Sbjct: 294 NLTHEDSIKYKYFLELGRIDSSTK---PCPQCKHFTTFKKKGHIPTPSRSESRYK-IQCP 349

Query: 198 VCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQ-----NKRWRRCQQCRR 252
            C+   C +C  PWH  ++C+EY+         GD  L   A       +  ++C +C+ 
Sbjct: 350 TCQLIWCFKCHSPWHEGVNCKEYKK--------GDKLLRHWASEIEHGQRNAQKCPKCKI 401

Query: 253 MIELTHGCYHMTC-WCGHEFCYSCGAEYR 280
            I+ T GC HMTC  C   FCY CG  YR
Sbjct: 402 HIQRTEGCDHMTCSQCNTNFCYRCGERYR 430
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9SKC4|ARI10_ARATH Probable E3 ubiquitin-protein ligase ARI10 OS=Arabidopsis thaliana GN=ARI10 PE=2 SV=1 Back     alignment and function description
>sp|Q4KLT0|RN217_XENLA Probable E3 ubiquitin-protein ligase RNF217 OS=Xenopus laevis GN=rnf217 PE=2 SV=1 Back     alignment and function description
>sp|Q9SKC3|ARI9_ARATH Probable E3 ubiquitin-protein ligase ARI9 OS=Arabidopsis thaliana GN=ARI9 PE=2 SV=1 Back     alignment and function description
>sp|P0CE10|Y4102_ARATH Putative uncharacterized protein At4g01020, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=4 SV=1 Back     alignment and function description
>sp|O76924|ARI2_DROME Protein ariadne-2 OS=Drosophila melanogaster GN=ari-2 PE=2 SV=1 Back     alignment and function description
>sp|Q9P3U4|YKX2_SCHPO Uncharacterized RING finger protein C328.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.02 PE=3 SV=1 Back     alignment and function description
>sp|Q8TC41|RN217_HUMAN Probable E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens GN=RNF217 PE=2 SV=3 Back     alignment and function description
>sp|P36113|YKZ7_YEAST RING finger protein YKR017C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR017C PE=1 SV=1 Back     alignment and function description
>sp|Q7Z419|R144B_HUMAN E3 ubiquitin-protein ligase RNF144B OS=Homo sapiens GN=RNF144B PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query391
225465698 525 PREDICTED: uncharacterized protein LOC10 0.969 0.721 0.850 1e-180
224136528 521 predicted protein [Populus trichocarpa] 0.969 0.727 0.842 1e-180
296085331463 unnamed protein product [Vitis vinifera] 0.969 0.818 0.850 1e-180
255580832 517 zinc finger protein, putative [Ricinus c 0.969 0.733 0.842 1e-178
224115510 501 predicted protein [Populus trichocarpa] 0.966 0.754 0.839 1e-177
356532399 511 PREDICTED: uncharacterized RING finger p 0.976 0.747 0.747 1e-171
449455425 515 PREDICTED: uncharacterized protein LOC10 0.966 0.733 0.778 1e-168
356558029 514 PREDICTED: uncharacterized protein LOC10 0.979 0.745 0.757 1e-167
357448361 520 E3 ubiquitin-protein ligase RNF216 [Medi 0.951 0.715 0.755 1e-167
297800082 532 zinc finger family protein [Arabidopsis 0.969 0.712 0.662 1e-145
>gi|225465698|ref|XP_002273428.1| PREDICTED: uncharacterized protein LOC100263135 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  638 bits (1645), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 325/382 (85%), Positives = 358/382 (93%), Gaps = 3/382 (0%)

Query: 13  ITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIAVGIVSSPSQGD 72
           I+  E+   PLL+AL+QRILE++SNLEAFVL L+PS +LERPL+LAQ+A+GIVSSPS+GD
Sbjct: 144 ISHAEEDGNPLLMALKQRILEFSSNLEAFVLNLIPSNDLERPLQLAQVAIGIVSSPSKGD 203

Query: 73  KSPENCSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFIST 132
            S ENCSICCEDKP PMMITMKCSHKFCSHCM+TY+DGKVQSSQVPIRCPQLRCKYFIST
Sbjct: 204 GSLENCSICCEDKPSPMMITMKCSHKFCSHCMKTYVDGKVQSSQVPIRCPQLRCKYFIST 263

Query: 133 VECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPRECLSARASSSSQSDNS 192
            EC+SFLP++ +ESLE ALAEAN+L+S++IYCPFPNCSVLLDPRECLSARASSSSQSDNS
Sbjct: 264 TECRSFLPVTCFESLERALAEANVLNSEKIYCPFPNCSVLLDPRECLSARASSSSQSDNS 323

Query: 193 CVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKRWRRCQQCRR 252
           CVECPVC+RFICV+CGVPWHSS+SCEEYQ+LPLEERDAGDITLHRLAQNKRWRRCQQCRR
Sbjct: 324 CVECPVCQRFICVDCGVPWHSSMSCEEYQSLPLEERDAGDITLHRLAQNKRWRRCQQCRR 383

Query: 253 MIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDEDNSEEL-TQSVHESEQSAW 311
           MIELT GCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDE+NSE+L + S+ ESEQ  W
Sbjct: 384 MIELTQGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDEENSEDLMSHSIQESEQWEW 443

Query: 312 ETFNSLPMI--MDAYSDQERSQLALIQRFLAGGFSLSDHHPYQSPPRCTDSYGDAMKDLH 369
           ++FNSLPM   MDAYSDQERSQLALIQRFLAGGFSLSDHHPYQSPPRCTDSY DAMKDLH
Sbjct: 444 DSFNSLPMTMGMDAYSDQERSQLALIQRFLAGGFSLSDHHPYQSPPRCTDSYVDAMKDLH 503

Query: 370 QLPWLERFVSVISDTYYEDYMQ 391
           QLPWLERFVSVISD YYEDY+Q
Sbjct: 504 QLPWLERFVSVISDNYYEDYIQ 525

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224136528|ref|XP_002322352.1| predicted protein [Populus trichocarpa] gi|222869348|gb|EEF06479.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296085331|emb|CBI29063.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255580832|ref|XP_002531236.1| zinc finger protein, putative [Ricinus communis] gi|223529173|gb|EEF31150.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224115510|ref|XP_002332152.1| predicted protein [Populus trichocarpa] gi|222875202|gb|EEF12333.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356532399|ref|XP_003534760.1| PREDICTED: uncharacterized RING finger protein C328.02-like [Glycine max] Back     alignment and taxonomy information
>gi|449455425|ref|XP_004145453.1| PREDICTED: uncharacterized protein LOC101221315 [Cucumis sativus] gi|449525776|ref|XP_004169892.1| PREDICTED: uncharacterized protein LOC101229267 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356558029|ref|XP_003547311.1| PREDICTED: uncharacterized protein LOC100783040 [Glycine max] Back     alignment and taxonomy information
>gi|357448361|ref|XP_003594456.1| E3 ubiquitin-protein ligase RNF216 [Medicago truncatula] gi|355483504|gb|AES64707.1| E3 ubiquitin-protein ligase RNF216 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297800082|ref|XP_002867925.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297313761|gb|EFH44184.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query391
TAIR|locus:2133935532 AT4G19670 [Arabidopsis thalian 0.953 0.701 0.658 2e-143
TAIR|locus:2040065373 AT2G25360 [Arabidopsis thalian 0.537 0.563 0.390 2.2e-41
TAIR|locus:2040025603 AT2G25370 [Arabidopsis thalian 0.662 0.429 0.358 5.3e-40
TAIR|locus:2143995655 AT5G60250 [Arabidopsis thalian 0.687 0.410 0.328 5.6e-40
TAIR|locus:2085622222 AT3G45470 [Arabidopsis thalian 0.514 0.905 0.384 4.8e-39
TAIR|locus:2084116320 AT3G53690 [Arabidopsis thalian 0.514 0.628 0.360 3.4e-38
TAIR|locus:2085672408 AT3G45580 [Arabidopsis thalian 0.621 0.595 0.340 7e-38
TAIR|locus:2091030303 AT3G14250 [Arabidopsis thalian 0.514 0.663 0.320 4.4e-36
TAIR|locus:2085612348 AT3G45540 [Arabidopsis thalian 0.647 0.727 0.340 5.7e-36
TAIR|locus:1006230127384 AT2G26135 [Arabidopsis thalian 0.583 0.593 0.347 1.5e-35
TAIR|locus:2133935 AT4G19670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1402 (498.6 bits), Expect = 2.0e-143, P = 2.0e-143
 Identities = 258/392 (65%), Positives = 312/392 (79%)

Query:    13 ITREEKLDIPLLVALRQRILEYTSNLEAFVLKLVPSIELERPLRLAQIAVGIVSSPSQGD 72
             ITREE+L+IPLLVALR+R+LE TSNL  FVLKL P  +L+  L LAQ+AVGIVSS   GD
Sbjct:   142 ITREEQLEIPLLVALRERVLEKTSNLNGFVLKLAPFCDLDEALSLAQVAVGIVSSNLDGD 201

Query:    73 KSPENCSICCEDKPYPMMITMKCSHKFCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFIST 132
             K  ENCSICCED+   MM+++KC+HKFCSHCM+TY++GKV++S+VPIRCPQ++CK+++S 
Sbjct:   202 KPIENCSICCEDRQSEMMLSLKCTHKFCSHCMKTYVEGKVKTSEVPIRCPQVQCKHYLSA 261

Query:   133 VECKSFLPLSSYESLETALAEANIL--HSDRIYCPFPNCSVLLDPRECLXXXXXXXXXXX 190
              ECKSFLP+++++S E    EAN+   ++ +IYCP+PNCS LLDP+ECL           
Sbjct:   262 AECKSFLPVTTFKSFE----EANVCSKNNGKIYCPYPNCSFLLDPQECLSSGRASSSSST 317

Query:   191 XX----CVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKRWRR 246
                   CVECPVCERF+CV+CGVPWH+S+SCEE+Q LP++ER   DITLHRLA+ KRWRR
Sbjct:   318 QSENSCCVECPVCERFVCVDCGVPWHASMSCEEFQILPVDERYPDDITLHRLARYKRWRR 377

Query:   247 CQQCRRMIELTHGCYHMTCWCGHEFCYSCGAEYRDGQQTCQCAFWDEDNSEELT----QS 302
             CQQCR MIEL  GC HMTC CGHEFCYSCGAEYR+GQQTC CAFWD+D  E+       +
Sbjct:   378 CQQCRIMIELAQGCNHMTCRCGHEFCYSCGAEYREGQQTCTCAFWDDDEEEQENAVEENT 437

Query:   303 VHESEQSAWETFNSLPMIMDAYSDQERSQLALIQRFLAGG-FSLSDHHP-YQSPPR-CTD 359
             + E EQ  W+TFNS+P +MDAYS+QERSQLALIQRFLAGG FSLSDHH  YQSPP  CT+
Sbjct:   438 IQEVEQWPWDTFNSIPTVMDAYSEQERSQLALIQRFLAGGGFSLSDHHTTYQSPPPPCTE 497

Query:   360 S-YGDA-MKDLHQLPWLERFVSVISDTYYEDY 389
             S Y +A MKDLHQLPWLERFVSVISD YYE+Y
Sbjct:   498 SSYVEAAMKDLHQLPWLERFVSVISDDYYEEY 529
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2040065 AT2G25360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040025 AT2G25370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143995 AT5G60250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085622 AT3G45470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084116 AT3G53690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085672 AT3G45580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091030 AT3G14250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085612 AT3G45540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230127 AT2G26135 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00031919001
SubName- Full=Chromosome undetermined scaffold_60, whole genome shotgun sequence; (463 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
smart0064764 smart00647, IBR, In Between Ring fingers 6e-07
pfam0148563 pfam01485, IBR, IBR domain 1e-04
>gnl|CDD|214763 smart00647, IBR, In Between Ring fingers Back     alignment and domain information 
 Score = 45.9 bits (109), Expect = 6e-07
 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 10/60 (16%)

Query: 158 HSDRIYCPFPNCSVLLDPRECLSARASSSSQSDNSCVECPVCERFICVECGVPWHSSLSC 217
           + D  +CP P+CS  +   E                V CP C    C  C VPWHS +SC
Sbjct: 15  NPDLKWCPAPDCSAAIIVTEEEGCN----------RVTCPKCGFSFCFRCKVPWHSPVSC 64

the domains occurs between pairs og RING fingers. Length = 64
>gnl|CDD|216524 pfam01485, IBR, IBR domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 391
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG1815444 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 99.95
smart0064764 IBR In Between Ring fingers. the domains occurs be 99.18
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 99.1
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.42
smart0064764 IBR In Between Ring fingers. the domains occurs be 98.37
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 98.31
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.24
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.18
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.17
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.13
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.12
PF1463444 zf-RING_5: zinc-RING finger domain 98.0
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.9
PHA02926242 zinc finger-like protein; Provisional 97.82
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.76
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.73
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.61
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.58
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.56
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.56
smart0050463 Ubox Modified RING finger domain. Modified RING fi 97.36
PHA02929238 N1R/p28-like protein; Provisional 97.36
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 97.18
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.0
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.99
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.95
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 96.93
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.84
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.44
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.26
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 96.18
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.13
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.13
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 95.63
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 95.29
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 95.16
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 95.14
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.78
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 94.75
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.74
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 94.08
KOG4367 699 consensus Predicted Zn-finger protein [Function un 93.96
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 93.78
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 93.73
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 93.39
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 93.11
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 92.82
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 92.55
KOG2660331 consensus Locus-specific chromosome binding protei 91.9
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 91.74
PHA0062659 hypothetical protein 91.71
COG5152259 Uncharacterized conserved protein, contains RING a 91.5
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 90.73
KOG3002299 consensus Zn finger protein [General function pred 90.64
smart0066152 RPOL9 RNA polymerase subunit 9. 90.43
KOG4739233 consensus Uncharacterized protein involved in syna 90.15
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 89.64
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 89.62
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 89.57
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 89.52
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 89.45
KOG4445368 consensus Uncharacterized conserved protein, conta 89.4
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 88.85
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 88.66
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 88.57
PF1324826 zf-ribbon_3: zinc-ribbon domain 88.36
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 88.12
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 87.68
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 87.66
PRK0043250 30S ribosomal protein S27ae; Validated 87.65
COG5175 480 MOT2 Transcriptional repressor [Transcription] 87.06
PF1324023 zinc_ribbon_2: zinc-ribbon domain 86.98
PRK14559 645 putative protein serine/threonine phosphatase; Pro 86.92
PF1371937 zinc_ribbon_5: zinc-ribbon domain 86.48
PHA03096284 p28-like protein; Provisional 86.15
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 86.14
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 86.12
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 85.84
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 85.75
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 85.56
PF1371736 zinc_ribbon_4: zinc-ribbon domain 85.36
PF1371937 zinc_ribbon_5: zinc-ribbon domain 85.08
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 84.95
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 84.05
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 82.71
PLN03086567 PRLI-interacting factor K; Provisional 82.56
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 81.78
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 81.72
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 81.39
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 80.3
KOG1001674 consensus Helicase-like transcription factor HLTF/ 80.12
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.8e-42  Score=335.44  Aligned_cols=254  Identities=40%  Similarity=0.826  Sum_probs=202.9

Q ss_pred             hHHHHHHHHHHHHHhhhhhhhhccCCcc-ccchHhHHHHHHhcCCCCCCCCCCCcccccccccccCCC-Ceeec-cCCCc
Q 016355           22 PLLVALRQRILEYTSNLEAFVLKLVPSI-ELERPLRLAQIAVGIVSSPSQGDKSPENCSICCEDKPYP-MMITM-KCSHK   98 (391)
Q Consensus        22 ~~l~~l~~~i~~~~~~~~~~~l~l~~~~-~~~~~~~~~~~ai~~~~~~~~~~~~~~~C~IC~e~~~~~-~~~~l-~C~H~   98 (391)
                      ..|++..+++++   .+......++++. |...+.++|.+++..   .........+|.||+.+.+.. .++.. .|+|.
T Consensus        98 ~~l~~~v~~~r~---~l~~~~~i~~~~~~d~~~~~~lA~e~i~s---~~~~~~~~~~C~iC~~e~~~~~~~f~~~~C~H~  171 (384)
T KOG1812|consen   98 VLLVELVQRIRE---QLTSSEPILVPKNADIKFAYKLAREAIVS---QLPSKLPKEECGICFVEDPEAEDMFSVLKCGHR  171 (384)
T ss_pred             HHHHHHHHHHHH---HhhcccceecccchhhHHHHHHHHHhhcc---ccccccccccCccCccccccHhhhHHHhcccch
Confidence            334444444444   4434455566554 777789999998876   222345688999999555544 66666 99999


Q ss_pred             ccHHHHHHHHHHHhhCCCcccccCCCccCCccCHHHHHhhCChhHHHHHHHHHHHHhcCCCCCccccCCCCCeeecCccc
Q 016355           99 FCSHCMRTYIDGKVQSSQVPIRCPQLRCKYFISTVECKSFLPLSSYESLETALAEANILHSDRIYCPFPNCSVLLDPREC  178 (391)
Q Consensus        99 fC~~Cl~~~i~~~i~~g~~~i~CP~~~C~~~i~~~~i~~~l~~~~~e~~~~~~~~~~i~~~~~~~CP~p~C~~~~~~~~~  178 (391)
                      ||.+|+++|++++...| ..++||..+|+..++.+.+..+|++++.++|++++.+.++...+.+|||+|+|+..+...+.
T Consensus       172 fC~~C~k~~iev~~~~~-~~~~C~~~~C~~~l~~~~c~~llt~kl~e~~e~~~~e~~i~~~~~~ycp~~~C~~l~~~~el  250 (384)
T KOG1812|consen  172 FCKDCVKQHIEVKLLSG-TVIRCPHDGCESRLTLESCRKLLTPKLREMWEQRLKEEVIPSLDRVYCPYPRCSSLMSKTEL  250 (384)
T ss_pred             hhhHHhHHHhhhhhccC-CCccCCCCCCCccCCHHHHhhhcCHHHHHHHHHHHHHHhhhhhhcccCCCCCchHhhhhhhh
Confidence            99999999999994444 44799999999999999999999999999999999999998666669999999999987544


Q ss_pred             cccccCCCCCCCCCeeeCCCCCcccccccccCCCCCCCchhHhcCcccccChhHHHHHHHHhccCCCCCccccceeeecC
Q 016355          179 LSARASSSSQSDNSCVECPVCERFICVECGVPWHSSLSCEEYQNLPLEERDAGDITLHRLAQNKRWRRCQQCRRMIELTH  258 (391)
Q Consensus       179 ~~~~~~~~~~~~~~~v~C~~C~~~fC~~C~~~~H~~~sC~e~~~~~~~~~~~~~~~~~~l~~~~~~k~CP~C~~~IeK~~  258 (391)
                      ..       ........|+.|+..||.+|+.+||.+.+|++|+++.. ....++.+++.++  ++||.||+|+..|++++
T Consensus       251 ~~-------~~~~~~~~C~~C~~~fCv~C~~~wh~~~sC~eykk~~~-~~~~d~~~~~~la--~~wr~CpkC~~~ie~~~  320 (384)
T KOG1812|consen  251 SS-------EVKSKRRPCVKCHELFCVKCKVPWHANLSCEEYKKLNP-EEYVDDITLKYLA--KRWRQCPKCKFMIELSE  320 (384)
T ss_pred             cc-------chhhcccccccCCCceeecCCCcCCCCCCHHHHHHhCC-cccccHHHHHHHH--HhcCcCcccceeeeecC
Confidence            31       12233456999999999999999999999999999987 3445577888888  78899999999999999


Q ss_pred             CCcceEeccccceeccccccccCCCCcc-cccCCC
Q 016355          259 GCYHMTCWCGHEFCYSCGAEYRDGQQTC-QCAFWD  292 (391)
Q Consensus       259 GCnhMtC~C~~~FCw~C~~~~~~~~~~c-~C~~~~  292 (391)
                      |||||||+||++|||.|+++|..+++.| .|.++.
T Consensus       321 GCnhm~CrC~~~fcy~C~~~~~~~~~~~~~~~r~~  355 (384)
T KOG1812|consen  321 GCNHMTCRCGHQFCYMCGGDWKTHNGECYECCRYK  355 (384)
T ss_pred             CcceEEeeccccchhhcCcchhhCCccccCccccc
Confidence            9999999999999999999998877643 344444

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query391
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 4e-11
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 7e-04
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
 Score = 58.3 bits (141), Expect = 4e-11
 Identities = 17/90 (18%), Positives = 34/90 (37%), Gaps = 4/90 (4%)

Query: 71  GDKSPENCSICCEDKPYPMMITMK-CSHKFCSHCMRTYIDGKVQSSQV-PIRCPQLRC-- 126
           G      C +C  + P   M T+  C   FC+ C++ Y++  ++      I CP   C  
Sbjct: 1   GSSGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIKEGLETAISCPDAACPK 60

Query: 127 KYFISTVECKSFLPLSSYESLETALAEANI 156
           +  +   E +  +     +  +    E + 
Sbjct: 61  QGHLQENEIECMVAAEIMQRYKKLQFERSG 90
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Length = 86 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query391
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 99.77
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.68
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 99.29
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 99.24
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.8
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.79
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.49
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.47
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.45
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.45
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.44
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.44
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.43
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.39
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.38
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.37
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.35
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.34
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.29
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.28
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.25
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.25
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.24
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.24
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.23
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.22
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.2
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.19
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.19
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.19
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.17
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.16
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.16
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.14
2ect_A78 Ring finger protein 126; metal binding protein, st 98.11
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.09
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.08
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.07
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.04
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.04
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.99
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.96
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.95
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.93
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.92
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.9
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.88
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.88
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.83
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.82
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.81
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 97.75
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.65
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.53
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.52
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.52
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.47
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.36
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.36
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.29
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.28
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 97.27
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.22
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.2
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.2
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.14
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.14
2ea5_A68 Cell growth regulator with ring finger domain prot 96.99
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 96.94
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.37
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 95.91
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 95.73
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 95.66
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 95.36
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 94.88
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 94.76
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 94.67
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 94.04
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 92.75
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 86.84
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 86.13
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 85.8
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 85.75
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 85.67
3nw0_A238 Non-structural maintenance of chromosomes element 85.37
2ysj_A63 Tripartite motif-containing protein 31; ring-type 85.28
2ysl_A73 Tripartite motif-containing protein 31; ring-type 84.8
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 84.74
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 84.73
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 84.46
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 84.23
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 83.43
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 83.02
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 82.39
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 82.18
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 81.94
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 80.33
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 80.12
1z60_A59 TFIIH basal transcription factor complex P44 subun 80.04
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.77  E-value=4.1e-20  Score=131.58  Aligned_cols=52  Identities=31%  Similarity=0.762  Sum_probs=47.1

Q ss_pred             cCCCCCccccceeeecCCCcceEe-c--cccceeccccccccCCCC-cccccCCCC
Q 016355          242 KRWRRCQQCRRMIELTHGCYHMTC-W--CGHEFCYSCGAEYRDGQQ-TCQCAFWDE  293 (391)
Q Consensus       242 ~~~k~CP~C~~~IeK~~GCnhMtC-~--C~~~FCw~C~~~~~~~~~-~c~C~~~~~  293 (391)
                      .++|+||+|+++|||++||||||| .  |+++|||+|+++|+.|+. .+.|++|++
T Consensus         4 ~~~k~CP~C~~~Iek~~GCnhmtC~~~~C~~~FCw~C~~~~~~~~~~~y~C~~y~~   59 (60)
T 1wd2_A            4 ANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNE   59 (60)
T ss_dssp             CCCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSGGGGTSSSSSCSCCC
T ss_pred             ccceECcCCCCeeEeCCCCCcEEECCCCcCCEEeeCcCCCcccCCCccccCCCccc
Confidence            356999999999999999999999 5  999999999999998865 479999986
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 391
d2ct7a173 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (H 1e-11
d1wd2a_60 g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Ho 2e-09
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 4e-07
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: IBR domain
domain: Ring finger protein 31
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 57.7 bits (139), Expect = 1e-11
 Identities = 12/67 (17%), Positives = 22/67 (32%), Gaps = 1/67 (1%)

Query: 232 DITLHRLAQNKRWRRCQQCRRMIELTHGCYHMTC-WCGHEFCYSCGAEYRDGQQTCQCAF 290
            +T   L ++ ++  C QC             TC  C   FC  C  ++ +  +   C  
Sbjct: 6   KLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCED 65

Query: 291 WDEDNSE 297
           +      
Sbjct: 66  FQNWKRM 72
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query391
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 99.76
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 99.62
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.26
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 99.07
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.41
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.35
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.31
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.19
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.12
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.06
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.0
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.97
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.97
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.94
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.88
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.84
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.7
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.93
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 96.41
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 95.68
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 95.35
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 89.23
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 88.41
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 87.4
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 85.67
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 83.1
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 83.1
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 83.02
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 82.61
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 81.6
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Ariadne-1 protein homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.76  E-value=4.8e-20  Score=129.31  Aligned_cols=51  Identities=31%  Similarity=0.793  Sum_probs=45.9

Q ss_pred             CCCCCccccceeeecCCCcceEec---cccceeccccccccCCCC-cccccCCCC
Q 016355          243 RWRRCQQCRRMIELTHGCYHMTCW---CGHEFCYSCGAEYRDGQQ-TCQCAFWDE  293 (391)
Q Consensus       243 ~~k~CP~C~~~IeK~~GCnhMtC~---C~~~FCw~C~~~~~~~~~-~c~C~~~~~  293 (391)
                      ++|+||+|+++|||++|||||||.   ||++|||+|+++|..++. .++|++|++
T Consensus         5 ntK~CP~C~~~ieK~~GCnhM~C~~~~C~~~fCw~C~~~~~~~~~~~~~C~~~~e   59 (60)
T d1wd2a_           5 NTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNE   59 (60)
T ss_dssp             CCCCCTTTCCCCSSCCSCCSSSCCSSGGGSCCSSSSCSCSGGGGTSSSSSCSCCC
T ss_pred             cCcCCCCCCCeEEECCCCCCeEeCCCCCCCeEECCCCCccccCCCCCCCCcCCcc
Confidence            459999999999999999999994   999999999999987654 468999986
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure