Citrus Sinensis ID: 016379
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 390 | ||||||
| 255579925 | 390 | conserved hypothetical protein [Ricinus | 0.997 | 0.997 | 0.792 | 0.0 | |
| 225456199 | 390 | PREDICTED: uncharacterized protein LOC10 | 0.987 | 0.987 | 0.805 | 0.0 | |
| 449439467 | 392 | PREDICTED: uncharacterized protein LOC10 | 0.997 | 0.992 | 0.774 | 0.0 | |
| 449526788 | 392 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.997 | 0.992 | 0.771 | 1e-180 | |
| 356520675 | 387 | PREDICTED: uncharacterized protein LOC10 | 0.982 | 0.989 | 0.747 | 1e-171 | |
| 356529493 | 392 | PREDICTED: uncharacterized protein LOC10 | 0.982 | 0.977 | 0.752 | 1e-171 | |
| 357499113 | 390 | hypothetical protein MTR_6g069810 [Medic | 0.987 | 0.987 | 0.686 | 1e-153 | |
| 15238244 | 374 | uncharacterized protein [Arabidopsis tha | 0.941 | 0.981 | 0.641 | 1e-137 | |
| 225463187 | 391 | PREDICTED: putative nuclease HARBI1-like | 0.923 | 0.920 | 0.513 | 1e-103 | |
| 356530983 | 481 | PREDICTED: uncharacterized protein LOC10 | 0.928 | 0.752 | 0.494 | 3e-96 |
| >gi|255579925|ref|XP_002530798.1| conserved hypothetical protein [Ricinus communis] gi|223529653|gb|EEF31599.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 657 bits (1696), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 309/390 (79%), Positives = 352/390 (90%), Gaps = 1/390 (0%)
Query: 1 MDSSDDEKDGVYGNHIPKELNHNLPSNGMKFVDEVLNGQSERCLENFRMDKKVFYKLCDI 60
M++SD+EKDG +GN++PKEL+ ++ +NG KFVDEVL GQS+RCLENFRMDK+VFYKLCDI
Sbjct: 1 MENSDEEKDGGFGNYMPKELSMSV-ANGTKFVDEVLAGQSDRCLENFRMDKQVFYKLCDI 59
Query: 61 LQSKGLLRHTNRIKIEEQLAIFMFIVGHNLRTRAVQELFRYSGETISRHFNNVLNAIMAI 120
LQ+KGLLRHTNRIKIEEQLAIF+FIVGHNLRTRAVQELFRYSGETISRHFNNVLNAIMAI
Sbjct: 60 LQAKGLLRHTNRIKIEEQLAIFLFIVGHNLRTRAVQELFRYSGETISRHFNNVLNAIMAI 119
Query: 121 SLDFFQPPGPDVPPEISLDPRLYPYFKDCVGAVDGIHIPVMVGVDEQGPFRNKSGLLSQN 180
SLDFF PPG DVP EI DPR YPYFKDCVGAVDGIHIPVMVGVDEQGPFR+K+GLLSQN
Sbjct: 120 SLDFFHPPGSDVPSEILGDPRFYPYFKDCVGAVDGIHIPVMVGVDEQGPFRDKNGLLSQN 179
Query: 181 VLAACSFDLKFHYVLAGWEGSASDLRVLNSALTRRNKLQVPEGKYYLVDNKYANMPGFIA 240
VLAACSFDLKFHYVLAGWEGSASDLRVLNSAL RRNKL VPE KYY+VD+KYAN+PGFIA
Sbjct: 180 VLAACSFDLKFHYVLAGWEGSASDLRVLNSALKRRNKLMVPEDKYYVVDSKYANLPGFIA 239
Query: 241 PYQAVSYHTNQTTTGYHPQDAKELFNQRHSLLRNATDRIFGALKERFPILLSAPPYPLQT 300
PY + + +++ ++ YHPQD +ELFNQRHSLLRNATDRIFGALK RFPIL+SAPPYPLQT
Sbjct: 240 PYNGIPHRSDEYSSAYHPQDPRELFNQRHSLLRNATDRIFGALKARFPILMSAPPYPLQT 299
Query: 301 QVKLVVAACALHNYIQREKPDDWLFRMYEQDTLLPMAESLLPLEGEQPIVHVDTRALEFG 360
QVKLVVAACA+HNYI+REKPDD +FRMYE D++L M ESL PLE EQP++ V+ +AL+ G
Sbjct: 300 QVKLVVAACAIHNYIRREKPDDLIFRMYEHDSILQMEESLPPLEMEQPMMQVEEQALDIG 359
Query: 361 FQTEQLELASHFRDSIATEMWDDYISGLAS 390
F TEQLE +S RDSIA+ +WDDYI L++
Sbjct: 360 FDTEQLEFSSQLRDSIASSLWDDYIRDLSA 389
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225456199|ref|XP_002282832.1| PREDICTED: uncharacterized protein LOC100262931 [Vitis vinifera] gi|147776987|emb|CAN67849.1| hypothetical protein VITISV_033748 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449439467|ref|XP_004137507.1| PREDICTED: uncharacterized protein LOC101221521 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449526788|ref|XP_004170395.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221521 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356520675|ref|XP_003528986.1| PREDICTED: uncharacterized protein LOC100778909 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356529493|ref|XP_003533325.1| PREDICTED: uncharacterized protein LOC100779133 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357499113|ref|XP_003619845.1| hypothetical protein MTR_6g069810 [Medicago truncatula] gi|355494860|gb|AES76063.1| hypothetical protein MTR_6g069810 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|15238244|ref|NP_199013.1| uncharacterized protein [Arabidopsis thaliana] gi|9757943|dbj|BAB08431.1| unnamed protein product [Arabidopsis thaliana] gi|28416671|gb|AAO42866.1| At5g41980 [Arabidopsis thaliana] gi|110743283|dbj|BAE99532.1| hypothetical protein [Arabidopsis thaliana] gi|332007366|gb|AED94749.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225463187|ref|XP_002267524.1| PREDICTED: putative nuclease HARBI1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356530983|ref|XP_003534058.1| PREDICTED: uncharacterized protein LOC100811756 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 390 | ||||||
| TAIR|locus:2165775 | 374 | AT5G41980 [Arabidopsis thalian | 0.948 | 0.989 | 0.636 | 4.2e-127 | |
| TAIR|locus:504956234 | 324 | AT1G43722 "AT1G43722" [Arabido | 0.697 | 0.839 | 0.347 | 3.9e-37 | |
| TAIR|locus:2148690 | 148 | AT5G28950 "AT5G28950" [Arabido | 0.233 | 0.614 | 0.608 | 2.9e-29 | |
| TAIR|locus:504954841 | 211 | AT5G35695 [Arabidopsis thalian | 0.448 | 0.829 | 0.388 | 8.7e-24 | |
| TAIR|locus:2184226 | 296 | AT5G28730 "AT5G28730" [Arabido | 0.176 | 0.233 | 0.471 | 1.3e-20 | |
| ZFIN|ZDB-GENE-050327-32 | 415 | zgc:113227 "zgc:113227" [Danio | 0.687 | 0.645 | 0.246 | 1.3e-10 | |
| RGD|1584007 | 349 | Harbi1 "harbinger transposase | 0.687 | 0.767 | 0.249 | 4e-10 | |
| UNIPROTKB|E2RCW9 | 349 | HARBI1 "Uncharacterized protei | 0.687 | 0.767 | 0.242 | 1.9e-09 | |
| UNIPROTKB|F1SIA2 | 349 | HARBI1 "Uncharacterized protei | 0.687 | 0.767 | 0.245 | 1.9e-09 | |
| UNIPROTKB|Q96MB7 | 349 | HARBI1 "Putative nuclease HARB | 0.687 | 0.767 | 0.242 | 3.3e-09 |
| TAIR|locus:2165775 AT5G41980 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1248 (444.4 bits), Expect = 4.2e-127, P = 4.2e-127
Identities = 249/391 (63%), Positives = 303/391 (77%)
Query: 1 MDSSDDEKDGVYGNHIPKELNHNLPSNGMKFVDEVLNGQSERCLENFRMDKKVFYKLCDI 60
+ +D+++ V +PKE++ S+G KFV ++LNG +E+C ENFRMDK VFYKLCD+
Sbjct: 3 ISGEEDKEEAVT---LPKEVSKISISDGNKFVYQILNGPNEQCFENFRMDKPVFYKLCDL 59
Query: 61 LQSKGLLRHTNRIKIEEQLAIFMFIVGHNLRTRAVQELFRYSGETISRHFNNVLNAIMAI 120
LQ++GLLRHTNRIKIE QLAIF+FI+GHNLRTRAVQELF YSGETISRHFNNVLNA++AI
Sbjct: 60 LQTRGLLRHTNRIKIEAQLAIFLFIIGHNLRTRAVQELFCYSGETISRHFNNVLNAVIAI 119
Query: 121 SLDFFQPPGPDVPPEISLDPRLYPYFKDCVGAVDGIHIPVMVGVDEQGPFRNKSGLLSQN 180
S DFFQP + D PYFKDCVG VD HIPVMVGVDEQGPFRN +GLL+QN
Sbjct: 120 SKDFFQPNSNS--DTLENDD---PYFKDCVGVVDSFHIPVMVGVDEQGPFRNGNGLLTQN 174
Query: 181 VLAACSFDLKFHYVLAGWEGSASDLRVLNSALTRRNKLQVPEGKYYLVDNKYANMPGFIA 240
VLAA SFDL+F+YVLAGWEGSASD +VLN+ALTRRNKLQVP+GKYY+VDNKY N+PGFIA
Sbjct: 175 VLAASSFDLRFNYVLAGWEGSASDQQVLNAALTRRNKLQVPQGKYYIVDNKYPNLPGFIA 234
Query: 241 PYQAVSYHTNQTTTGYHPQDAKELFNQRHSLLRNATDRIFGALKERFPILLSAPPYPLQT 300
PY VS TN ++AKE+FN+RH LL A R FGALKERFPILLSAPPYPLQT
Sbjct: 235 PYHGVS--TNSR------EEAKEMFNERHKLLHRAIHRTFGALKERFPILLSAPPYPLQT 286
Query: 301 QVKLVVAACALHNYIQREKPDDWLFRMYEQDTLLPMAESL-LPLEGEQPIVHVDTRALEF 359
QVKLV+AACALHNY++ EKPDD +FRM+E++TL E + LE EQ V+ E
Sbjct: 287 QVKLVIAACALHNYVRLEKPDDLVFRMFEEETLAEAGEDREVALEEEQ----VEIVGQEH 342
Query: 360 GFQTEQLELASHFRDSIATEMWDDYISGLAS 390
GF+ E++E + RD IA+E+W+ Y+ +++
Sbjct: 343 GFRPEEVEDSLRLRDEIASELWNHYVQNMST 373
|
|
| TAIR|locus:504956234 AT1G43722 "AT1G43722" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2148690 AT5G28950 "AT5G28950" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504954841 AT5G35695 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2184226 AT5G28730 "AT5G28730" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050327-32 zgc:113227 "zgc:113227" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1584007 Harbi1 "harbinger transposase derived 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RCW9 HARBI1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SIA2 HARBI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96MB7 HARBI1 "Putative nuclease HARBI1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00017866001 | SubName- Full=Putative uncharacterized protein (Chromosome chr17 scaffold_16, whole genome shotgun sequence); (390 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 390 | |||
| pfam13359 | 155 | pfam13359, DDE_4, DDE superfamily endonuclease | 2e-27 | |
| pfam04827 | 205 | pfam04827, Plant_tran, Plant transposon protein | 7e-04 |
| >gnl|CDD|222071 pfam13359, DDE_4, DDE superfamily endonuclease | Back alignment and domain information |
|---|
Score = 105 bits (265), Expect = 2e-27
Identities = 48/166 (28%), Positives = 68/166 (40%), Gaps = 16/166 (9%)
Query: 153 VDGIHIPVMVGVDEQG---PFRNKSGLLSQNVLAACSFDLKFHYVLAGWEGSASDLRVL- 208
+DG IP+ + + + VL D + +V GW GS SD R+L
Sbjct: 1 IDGTEIPIERPKSLEEQAQTYSGYKKHNTLKVLIVVDPDGRIIFVSVGWPGSVSDKRILE 60
Query: 209 NSALTRRNKLQVPEGKYYLVDNKYANMPGFIAPYQAVSYHTNQTTTGYHPQDAKELFNQR 268
NS L ++P G Y L D + +AP T + + FN+R
Sbjct: 61 NSGL----LEKLPPGDYVLADRGFPLSDSLLAPPAKKPGGAQLT-------EEEVEFNRR 109
Query: 269 HSLLRNATDRIFGALKERFPILLSAPPY-PLQTQVKLVVAACALHN 313
+ R +R+ G LK RF IL L T K+V+ CALHN
Sbjct: 110 IASARIHVERVIGRLKGRFRILRGRLRISKLTTLDKIVLVCCALHN 155
|
This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. Length = 155 |
| >gnl|CDD|203098 pfam04827, Plant_tran, Plant transposon protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 390 | |||
| KOG4585 | 326 | consensus Predicted transposase [Replication, reco | 100.0 | |
| PF04827 | 205 | Plant_tran: Plant transposon protein; InterPro: IP | 100.0 | |
| PF13359 | 158 | DDE_Tnp_4: DDE superfamily endonuclease | 100.0 | |
| PF13613 | 53 | HTH_Tnp_4: Helix-turn-helix of DDE superfamily end | 98.94 | |
| PF13612 | 155 | DDE_Tnp_1_3: Transposase DDE domain | 98.9 | |
| PF01609 | 213 | DDE_Tnp_1: Transposase DDE domain; InterPro: IPR00 | 98.09 | |
| PF13586 | 88 | DDE_Tnp_1_2: Transposase DDE domain | 97.16 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 96.28 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 96.2 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 95.59 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 95.5 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 95.42 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 94.98 | |
| PF12116 | 82 | SpoIIID: Stage III sporulation protein D; InterPro | 94.68 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 94.55 | |
| PF05225 | 45 | HTH_psq: helix-turn-helix, Psq domain; InterPro: I | 93.99 | |
| smart00351 | 125 | PAX Paired Box domain. | 93.83 | |
| COG3415 | 138 | Transposase and inactivated derivatives [DNA repli | 93.53 | |
| PF13011 | 85 | LZ_Tnp_IS481: leucine-zipper of insertion element | 93.42 | |
| PF13340 | 75 | DUF4096: Putative transposase of IS4/5 family (DUF | 93.29 | |
| cd00131 | 128 | PAX Paired Box domain | 93.02 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 92.68 | |
| PF01527 | 76 | HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp | 92.65 | |
| smart00421 | 58 | HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo | 92.61 | |
| PRK04217 | 110 | hypothetical protein; Provisional | 92.6 | |
| TIGR02531 | 88 | yecD_yerC TrpR-related protein YerC/YecD. This mod | 92.32 | |
| cd06171 | 55 | Sigma70_r4 Sigma70, region (SR) 4 refers to the mo | 91.72 | |
| PRK00118 | 104 | putative DNA-binding protein; Validated | 91.26 | |
| PRK09639 | 166 | RNA polymerase sigma factor SigX; Provisional | 91.04 | |
| PF02209 | 36 | VHP: Villin headpiece domain; InterPro: IPR003128 | 90.47 | |
| PF13542 | 52 | HTH_Tnp_ISL3: Helix-turn-helix domain of transposa | 89.96 | |
| PRK12529 | 178 | RNA polymerase sigma factor; Provisional | 89.87 | |
| TIGR03879 | 73 | near_KaiC_dom probable regulatory domain. This mod | 89.61 | |
| cd06170 | 57 | LuxR_C_like C-terminal DNA-binding domain of LuxR- | 89.61 | |
| PRK09652 | 182 | RNA polymerase sigma factor RpoE; Provisional | 89.16 | |
| PRK08301 | 234 | sporulation sigma factor SigE; Reviewed | 88.98 | |
| cd00569 | 42 | HTH_Hin_like Helix-turn-helix domain of Hin and re | 88.88 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 88.76 | |
| smart00153 | 36 | VHP Villin headpiece domain. | 88.72 | |
| PRK12519 | 194 | RNA polymerase sigma factor; Provisional | 88.58 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 88.44 | |
| PRK12522 | 173 | RNA polymerase sigma factor; Provisional | 87.97 | |
| PRK05911 | 257 | RNA polymerase sigma factor sigma-28; Reviewed | 87.96 | |
| TIGR02989 | 159 | Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop | 87.6 | |
| PRK07037 | 163 | extracytoplasmic-function sigma-70 factor; Validat | 87.57 | |
| TIGR02999 | 183 | Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f | 87.52 | |
| TIGR02952 | 170 | Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02 | 87.47 | |
| PRK09415 | 179 | RNA polymerase factor sigma C; Reviewed | 87.46 | |
| cd06571 | 90 | Bac_DnaA_C C-terminal domain of bacterial DnaA pro | 87.4 | |
| PRK09047 | 161 | RNA polymerase factor sigma-70; Validated | 87.3 | |
| PRK12537 | 182 | RNA polymerase sigma factor; Provisional | 87.25 | |
| COG1595 | 182 | RpoE DNA-directed RNA polymerase specialized sigma | 87.23 | |
| TIGR00721 | 137 | tfx DNA-binding protein, Tfx family. Tfx from Meth | 87.22 | |
| PF00356 | 46 | LacI: Bacterial regulatory proteins, lacI family; | 87.21 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 87.19 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 87.14 | |
| PRK12530 | 189 | RNA polymerase sigma factor; Provisional | 87.0 | |
| PF00196 | 58 | GerE: Bacterial regulatory proteins, luxR family; | 86.97 | |
| PRK12511 | 182 | RNA polymerase sigma factor; Provisional | 86.96 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 86.81 | |
| PRK12528 | 161 | RNA polymerase sigma factor; Provisional | 86.71 | |
| PRK12514 | 179 | RNA polymerase sigma factor; Provisional | 86.69 | |
| PRK05803 | 233 | sporulation sigma factor SigK; Reviewed | 86.67 | |
| PRK12547 | 164 | RNA polymerase sigma factor; Provisional | 86.61 | |
| PRK15320 | 251 | transcriptional activator SprB; Provisional | 86.56 | |
| TIGR02983 | 162 | SigE-fam_strep RNA polymerase sigma-70 factor, sig | 86.53 | |
| PF13751 | 125 | DDE_Tnp_1_6: Transposase DDE domain | 86.52 | |
| TIGR02985 | 161 | Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba | 86.48 | |
| PRK12533 | 216 | RNA polymerase sigma factor; Provisional | 86.42 | |
| PRK12525 | 168 | RNA polymerase sigma factor; Provisional | 86.37 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 86.26 | |
| TIGR02937 | 158 | sigma70-ECF RNA polymerase sigma factor, sigma-70 | 86.24 | |
| PRK09642 | 160 | RNA polymerase sigma factor SigW; Reviewed | 86.15 | |
| PRK12516 | 187 | RNA polymerase sigma factor; Provisional | 86.1 | |
| PRK09638 | 176 | RNA polymerase sigma factor SigY; Reviewed | 86.06 | |
| PRK09641 | 187 | RNA polymerase sigma factor SigW; Provisional | 85.64 | |
| PRK12524 | 196 | RNA polymerase sigma factor; Provisional | 85.61 | |
| TIGR02950 | 154 | SigM_subfam RNA polymerase sigma factor, SigM fami | 85.55 | |
| PRK13919 | 186 | putative RNA polymerase sigma E protein; Provision | 85.5 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 85.35 | |
| PF05344 | 65 | DUF746: Domain of Unknown Function (DUF746); Inter | 85.34 | |
| PRK03975 | 141 | tfx putative transcriptional regulator; Provisiona | 85.33 | |
| PRK11923 | 193 | algU RNA polymerase sigma factor AlgU; Provisional | 85.26 | |
| TIGR02844 | 80 | spore_III_D sporulation transcriptional regulator | 85.08 | |
| TIGR02835 | 234 | spore_sigmaE RNA polymerase sigma-E factor. Member | 85.08 | |
| PRK07408 | 256 | RNA polymerase sigma factor SigF; Reviewed | 84.98 | |
| PRK11924 | 179 | RNA polymerase sigma factor; Provisional | 84.96 | |
| PF01047 | 59 | MarR: MarR family; InterPro: IPR000835 The MarR-ty | 84.94 | |
| TIGR02392 | 270 | rpoH_proteo alternative sigma factor RpoH. A sigma | 84.84 | |
| PRK06759 | 154 | RNA polymerase factor sigma-70; Validated | 84.81 | |
| PRK12515 | 189 | RNA polymerase sigma factor; Provisional | 84.67 | |
| PRK12531 | 194 | RNA polymerase sigma factor; Provisional | 84.56 | |
| PRK09637 | 181 | RNA polymerase sigma factor SigZ; Provisional | 84.51 | |
| TIGR02939 | 190 | RpoE_Sigma70 RNA polymerase sigma factor RpoE. A s | 84.43 | |
| PRK12534 | 187 | RNA polymerase sigma factor; Provisional | 84.39 | |
| PRK09645 | 173 | RNA polymerase sigma factor SigL; Provisional | 84.39 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 84.35 | |
| PHA00675 | 78 | hypothetical protein | 84.32 | |
| PF01371 | 87 | Trp_repressor: Trp repressor protein; InterPro: IP | 84.32 | |
| PRK12523 | 172 | RNA polymerase sigma factor; Reviewed | 84.23 | |
| PRK12536 | 181 | RNA polymerase sigma factor; Provisional | 84.23 | |
| PRK12520 | 191 | RNA polymerase sigma factor; Provisional | 84.14 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 84.1 | |
| PF07374 | 100 | DUF1492: Protein of unknown function (DUF1492); In | 84.08 | |
| PF00872 | 381 | Transposase_mut: Transposase, Mutator family; Inte | 83.77 | |
| TIGR02984 | 189 | Sig-70_plancto1 RNA polymerase sigma-70 factor, Pl | 83.72 | |
| TIGR02959 | 170 | SigZ RNA polymerase sigma factor, SigZ family. Thi | 83.69 | |
| PRK09651 | 172 | RNA polymerase sigma factor FecI; Provisional | 83.64 | |
| COG2739 | 105 | Uncharacterized protein conserved in bacteria [Fun | 83.56 | |
| PRK12541 | 161 | RNA polymerase sigma factor; Provisional | 83.54 | |
| PRK09649 | 185 | RNA polymerase sigma factor SigC; Reviewed | 83.53 | |
| PF13551 | 112 | HTH_29: Winged helix-turn helix | 83.44 | |
| PRK12545 | 201 | RNA polymerase sigma factor; Provisional | 83.39 | |
| PRK12532 | 195 | RNA polymerase sigma factor; Provisional | 83.31 | |
| TIGR02393 | 238 | RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter | 83.23 | |
| TIGR03001 | 244 | Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxoco | 83.19 | |
| PRK12512 | 184 | RNA polymerase sigma factor; Provisional | 83.02 | |
| PRK12543 | 179 | RNA polymerase sigma factor; Provisional | 82.92 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 82.83 | |
| PRK12546 | 188 | RNA polymerase sigma factor; Provisional | 82.82 | |
| TIGR02954 | 169 | Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02 | 82.78 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 82.78 | |
| PRK12535 | 196 | RNA polymerase sigma factor; Provisional | 82.77 | |
| PRK05572 | 252 | sporulation sigma factor SigF; Validated | 82.74 | |
| PRK12542 | 185 | RNA polymerase sigma factor; Provisional | 82.63 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 82.54 | |
| PRK09644 | 165 | RNA polymerase sigma factor SigM; Provisional | 82.51 | |
| smart00342 | 84 | HTH_ARAC helix_turn_helix, arabinose operon contro | 82.4 | |
| PRK09643 | 192 | RNA polymerase sigma factor SigM; Reviewed | 82.37 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 82.37 | |
| TIGR02947 | 193 | SigH_actino RNA polymerase sigma-70 factor, TIGR02 | 82.35 | |
| PRK05602 | 186 | RNA polymerase sigma factor; Reviewed | 82.31 | |
| PRK06930 | 170 | positive control sigma-like factor; Validated | 82.29 | |
| PRK12540 | 182 | RNA polymerase sigma factor; Provisional | 82.27 | |
| PRK12527 | 159 | RNA polymerase sigma factor; Reviewed | 82.25 | |
| TIGR02846 | 227 | spore_sigmaK RNA polymerase sigma-K factor. The sp | 82.17 | |
| PF01710 | 119 | HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr | 82.13 | |
| TIGR02948 | 187 | SigW_bacill RNA polymerase sigma-W factor. This si | 82.09 | |
| PRK06596 | 284 | RNA polymerase factor sigma-32; Reviewed | 82.01 | |
| PRK12526 | 206 | RNA polymerase sigma factor; Provisional | 81.85 | |
| PRK12538 | 233 | RNA polymerase sigma factor; Provisional | 81.68 | |
| PRK12544 | 206 | RNA polymerase sigma factor; Provisional | 81.65 | |
| PRK12539 | 184 | RNA polymerase sigma factor; Provisional | 81.53 | |
| TIGR02980 | 227 | SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G | 81.46 | |
| PRK08583 | 257 | RNA polymerase sigma factor SigB; Validated | 81.22 | |
| TIGR02394 | 285 | rpoS_proteo RNA polymerase sigma factor RpoS. A si | 81.03 | |
| PRK07500 | 289 | rpoH2 RNA polymerase factor sigma-32; Reviewed | 81.02 | |
| PRK06811 | 189 | RNA polymerase factor sigma-70; Validated | 80.95 | |
| PF04297 | 101 | UPF0122: Putative helix-turn-helix protein, YlxM / | 80.71 | |
| PRK09646 | 194 | RNA polymerase sigma factor SigK; Reviewed | 80.38 | |
| TIGR02943 | 188 | Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02 | 80.34 |
| >KOG4585 consensus Predicted transposase [Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-43 Score=334.56 Aligned_cols=311 Identities=31% Similarity=0.518 Sum_probs=257.1
Q ss_pred hcCCCHHHHHHHHHHhccCCccccC-----CCCCHHHHHHHHhhhcccccchhhhhhhcccchhhhhhhhHHHHHHHHHh
Q 016379 46 NFRMDKKVFYKLCDILQSKGLLRHT-----NRIKIEEQLAIFMFIVGHNLRTRAVQELFRYSGETISRHFNNVLNAIMAI 120 (390)
Q Consensus 46 ~frms~~~F~~L~~~L~~~~~~~~~-----~~~~~~~~l~~~L~~L~~~~~~~~l~~~fgis~stv~~~~~~v~~~l~~~ 120 (390)
.|++++.+|..++............ ..+++...+++.++.++++.+.+.++..||...+|+ .+.......
T Consensus 7 ~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~i~~~fg~~~~~~-----~~~~~~~~~ 81 (326)
T KOG4585|consen 7 EFRKSYTTFDKICSLVQSLNVVKNSGFMLSSLLPADTLVAVALWRLKTGESLRTVEKKFGLGQSTC-----KFLEEKEDL 81 (326)
T ss_pred HHHHHHHHHHHHhhhhhhhhhhcccchhhhccccHHhhhhhhhccccccchHHHHHHHcCCcchhh-----hHHHhhhcc
Confidence 7888999999999987654322111 123388999999999999999999999999999999 555566678
Q ss_pred hccccCCCCCCCchhhccCCcccCCCccccccccceEEEEEeCCCCCCCCCCCCCCceeeeeeeecCCcceeEeccCccc
Q 016379 121 SLDFFQPPGPDVPPEISLDPRLYPYFKDCVGAVDGIHIPVMVGVDEQGPFRNKSGLLSQNVLAACSFDLKFHYVLAGWEG 200 (390)
Q Consensus 121 ~~~~i~~P~~~~~~~i~~~~~~~~~fp~~iG~IDgt~i~i~~P~~~~~~y~~~k~~~s~~~q~v~d~d~~~~~v~~g~~G 200 (390)
+..++.||.......+.+.++. +|+|+|+||+|||++..|......|.|+ .++.|+|+|||+|++|++|.+||||
T Consensus 82 ~~~~~~~p~~~~~~~i~~~~~~---~~~~~g~~d~~hi~~~~~~~~~~~~~n~--~~~~Nvlav~n~d~~f~~v~vg~~G 156 (326)
T KOG4585|consen 82 APHFLKWPSRRILYEIRERFES---LPNCVGAIDTTHIPIRVPPKSGSVYFNK--EQSKNLLAVCNFDMRFIYVDVGWPG 156 (326)
T ss_pred cchhhcCchhhhhhhhcccccc---ccchhccccccccceecCcccccccccc--ccchhhhheecCCceEEEEEccCCC
Confidence 9999999997666777665543 9999999999999999999999999988 8899999999999999999999999
Q ss_pred ccccHHHHHHHHhh-cCCCCCCCCceeeccCCCCCCCCccccccCcccCcccccCCCC-ChhhHHHHHHHHHHHHhHHHH
Q 016379 201 SASDLRVLNSALTR-RNKLQVPEGKYYLVDNKYANMPGFIAPYQAVSYHTNQTTTGYH-PQDAKELFNQRHSLLRNATDR 278 (390)
Q Consensus 201 s~~D~~vl~~sl~~-~~~~~~p~g~~~l~D~gYp~~~~ll~P~~~~~~~~~~~~~~~~-~~~~~~~fN~~~s~~R~~VE~ 278 (390)
|.||+.|++.++.. ......|. +|+|.|.||++.++++.|+..+.++.-.+..+++ |+..+++||++|+.+|.++|+
T Consensus 157 s~~D~kvl~~~~~~~~~~~~~~~-k~yl~d~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~elFN~rh~~~r~v~e~ 235 (326)
T KOG4585|consen 157 SAHDTKVLQDSLLYKRNFPHPPL-KYYLVDSGYPLRPGLLGPIGFPLYSLLMFPYGGPQPTNSQELFNKRHSSLRSVAER 235 (326)
T ss_pred CccHHHHHHhhcccccccccCCc-cccccccCcccccccccccccccchhhhcccCCCCCCchHHHHhhhhhhHHHHHHH
Confidence 99999999988654 33334455 9999999999999999999999999988887774 889999999999999999999
Q ss_pred HHHHHHhhchhhhcCCCCCccchhHHHHHHHHHHhhhhccCCCcccccccccCCcccccccCCCCCCCCCCCCCCccccc
Q 016379 279 IFGALKERFPILLSAPPYPLQTQVKLVVAACALHNYIQREKPDDWLFRMYEQDTLLPMAESLLPLEGEQPIVHVDTRALE 358 (390)
Q Consensus 279 ~fg~LK~rf~iL~~~~~~~~~~~~~ii~a~~~LhN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 358 (390)
+||+||+||+||.+...+...+..+||.|||+|||++++.+..+..+..++... .+. .+...
T Consensus 236 ~fg~lk~rw~il~~~~~~~~~~~~~iV~a~caLHN~~~~~~~~~~~~~~~e~~~--------------d~~----~~~~~ 297 (326)
T KOG4585|consen 236 AFGVLKAKWRILQRREKYDLKKLPKIVTACCALHNIIRDSDEEDPDDPKWEKFD--------------DYG----ENVAH 297 (326)
T ss_pred HHHHhhhhhHHHhhcccccccchHHHHHHHHHHHHHHHhhcccccccccccccc--------------ccc----ccchh
Confidence 999999999999977778899999999999999999999887664433221111 000 01111
Q ss_pred cccchHHHHHHHHHHHHHHHHHHHHhh
Q 016379 359 FGFQTEQLELASHFRDSIATEMWDDYI 385 (390)
Q Consensus 359 ~~~~~~~~~~~~~~Rd~ia~~lw~~~~ 385 (390)
.....+.++.++.+|+.|+..||+...
T Consensus 298 ~~~~~~~~~~~~~~r~~l~~~l~~~~~ 324 (326)
T KOG4585|consen 298 LRYAPQQRDYMEKIRDNLLSELWNGTR 324 (326)
T ss_pred cccchhHHHHHHHHHHHHHHHHHhccc
Confidence 233456778899999999999998753
|
|
| >PF04827 Plant_tran: Plant transposon protein; InterPro: IPR006912 This entry represents a putative Harbinger transposase-derived nuclease, which is thought to have nuclease activity | Back alignment and domain information |
|---|
| >PF13359 DDE_Tnp_4: DDE superfamily endonuclease | Back alignment and domain information |
|---|
| >PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease | Back alignment and domain information |
|---|
| >PF13612 DDE_Tnp_1_3: Transposase DDE domain | Back alignment and domain information |
|---|
| >PF01609 DDE_Tnp_1: Transposase DDE domain; InterPro: IPR002559 Autonomous mobile genetic elements such as transposon or insertion sequences (IS) encode an enzyme, transposase, that is required for excising and inserting the mobile element | Back alignment and domain information |
|---|
| >PF13586 DDE_Tnp_1_2: Transposase DDE domain | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] | Back alignment and domain information |
|---|
| >smart00351 PAX Paired Box domain | Back alignment and domain information |
|---|
| >COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13011 LZ_Tnp_IS481: leucine-zipper of insertion element IS481 | Back alignment and domain information |
|---|
| >PF13340 DUF4096: Putative transposase of IS4/5 family (DUF4096) | Back alignment and domain information |
|---|
| >cd00131 PAX Paired Box domain | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >smart00421 HTH_LUXR helix_turn_helix, Lux Regulon | Back alignment and domain information |
|---|
| >PRK04217 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02531 yecD_yerC TrpR-related protein YerC/YecD | Back alignment and domain information |
|---|
| >cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) | Back alignment and domain information |
|---|
| >PRK00118 putative DNA-binding protein; Validated | Back alignment and domain information |
|---|
| >PRK09639 RNA polymerase sigma factor SigX; Provisional | Back alignment and domain information |
|---|
| >PF02209 VHP: Villin headpiece domain; InterPro: IPR003128 Villin is an F-actin bundling protein involved in the maintenance of the microvilli of the absorptive epithelia | Back alignment and domain information |
|---|
| >PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 | Back alignment and domain information |
|---|
| >PRK12529 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR03879 near_KaiC_dom probable regulatory domain | Back alignment and domain information |
|---|
| >cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins | Back alignment and domain information |
|---|
| >PRK09652 RNA polymerase sigma factor RpoE; Provisional | Back alignment and domain information |
|---|
| >PRK08301 sporulation sigma factor SigE; Reviewed | Back alignment and domain information |
|---|
| >cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >smart00153 VHP Villin headpiece domain | Back alignment and domain information |
|---|
| >PRK12519 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PRK12522 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK05911 RNA polymerase sigma factor sigma-28; Reviewed | Back alignment and domain information |
|---|
| >TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family | Back alignment and domain information |
|---|
| >PRK07037 extracytoplasmic-function sigma-70 factor; Validated | Back alignment and domain information |
|---|
| >TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family | Back alignment and domain information |
|---|
| >TIGR02952 Sig70_famx2 RNA polymerase sigma-70 factor, TIGR02952 family | Back alignment and domain information |
|---|
| >PRK09415 RNA polymerase factor sigma C; Reviewed | Back alignment and domain information |
|---|
| >cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins | Back alignment and domain information |
|---|
| >PRK09047 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK12537 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] | Back alignment and domain information |
|---|
| >TIGR00721 tfx DNA-binding protein, Tfx family | Back alignment and domain information |
|---|
| >PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK12530 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators | Back alignment and domain information |
|---|
| >PRK12511 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >PRK12528 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12514 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK05803 sporulation sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >PRK12547 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK15320 transcriptional activator SprB; Provisional | Back alignment and domain information |
|---|
| >TIGR02983 SigE-fam_strep RNA polymerase sigma-70 factor, sigma-E family | Back alignment and domain information |
|---|
| >PF13751 DDE_Tnp_1_6: Transposase DDE domain | Back alignment and domain information |
|---|
| >TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 | Back alignment and domain information |
|---|
| >PRK12533 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12525 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family | Back alignment and domain information |
|---|
| >PRK09642 RNA polymerase sigma factor SigW; Reviewed | Back alignment and domain information |
|---|
| >PRK12516 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09638 RNA polymerase sigma factor SigY; Reviewed | Back alignment and domain information |
|---|
| >PRK09641 RNA polymerase sigma factor SigW; Provisional | Back alignment and domain information |
|---|
| >PRK12524 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02950 SigM_subfam RNA polymerase sigma factor, SigM family | Back alignment and domain information |
|---|
| >PRK13919 putative RNA polymerase sigma E protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >PF05344 DUF746: Domain of Unknown Function (DUF746); InterPro: IPR008008 This is a short conserved region found in some transposons | Back alignment and domain information |
|---|
| >PRK03975 tfx putative transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11923 algU RNA polymerase sigma factor AlgU; Provisional | Back alignment and domain information |
|---|
| >TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID | Back alignment and domain information |
|---|
| >TIGR02835 spore_sigmaE RNA polymerase sigma-E factor | Back alignment and domain information |
|---|
| >PRK07408 RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >PRK11924 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance | Back alignment and domain information |
|---|
| >TIGR02392 rpoH_proteo alternative sigma factor RpoH | Back alignment and domain information |
|---|
| >PRK06759 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PRK12515 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12531 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09637 RNA polymerase sigma factor SigZ; Provisional | Back alignment and domain information |
|---|
| >TIGR02939 RpoE_Sigma70 RNA polymerase sigma factor RpoE | Back alignment and domain information |
|---|
| >PRK12534 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09645 RNA polymerase sigma factor SigL; Provisional | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >PHA00675 hypothetical protein | Back alignment and domain information |
|---|
| >PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression | Back alignment and domain information |
|---|
| >PRK12523 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK12536 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12520 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF07374 DUF1492: Protein of unknown function (DUF1492); InterPro: IPR010861 This entry is represented by Streptococcus phage 7201, Orf19 | Back alignment and domain information |
|---|
| >PF00872 Transposase_mut: Transposase, Mutator family; InterPro: IPR001207 Autonomous mobile genetic elements such as transposon or insertion sequences (IS) encode an enzyme, transposase, that is required for excising and inserting the mobile element | Back alignment and domain information |
|---|
| >TIGR02984 Sig-70_plancto1 RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 | Back alignment and domain information |
|---|
| >TIGR02959 SigZ RNA polymerase sigma factor, SigZ family | Back alignment and domain information |
|---|
| >PRK09651 RNA polymerase sigma factor FecI; Provisional | Back alignment and domain information |
|---|
| >COG2739 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK12541 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK09649 RNA polymerase sigma factor SigC; Reviewed | Back alignment and domain information |
|---|
| >PF13551 HTH_29: Winged helix-turn helix | Back alignment and domain information |
|---|
| >PRK12545 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12532 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain | Back alignment and domain information |
|---|
| >TIGR03001 Sig-70_gmx1 RNA polymerase sigma-70 factor, Myxococcales family 1 | Back alignment and domain information |
|---|
| >PRK12512 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12543 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >PRK12546 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02954 Sig70_famx3 RNA polymerase sigma-70 factor, TIGR02954 family | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PRK12535 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK05572 sporulation sigma factor SigF; Validated | Back alignment and domain information |
|---|
| >PRK12542 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >PRK09644 RNA polymerase sigma factor SigM; Provisional | Back alignment and domain information |
|---|
| >smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein | Back alignment and domain information |
|---|
| >PRK09643 RNA polymerase sigma factor SigM; Reviewed | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >TIGR02947 SigH_actino RNA polymerase sigma-70 factor, TIGR02947 family | Back alignment and domain information |
|---|
| >PRK05602 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >PRK06930 positive control sigma-like factor; Validated | Back alignment and domain information |
|---|
| >PRK12540 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12527 RNA polymerase sigma factor; Reviewed | Back alignment and domain information |
|---|
| >TIGR02846 spore_sigmaK RNA polymerase sigma-K factor | Back alignment and domain information |
|---|
| >PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >TIGR02948 SigW_bacill RNA polymerase sigma-W factor | Back alignment and domain information |
|---|
| >PRK06596 RNA polymerase factor sigma-32; Reviewed | Back alignment and domain information |
|---|
| >PRK12526 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12538 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12544 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >PRK12539 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily | Back alignment and domain information |
|---|
| >PRK08583 RNA polymerase sigma factor SigB; Validated | Back alignment and domain information |
|---|
| >TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS | Back alignment and domain information |
|---|
| >PRK07500 rpoH2 RNA polymerase factor sigma-32; Reviewed | Back alignment and domain information |
|---|
| >PRK06811 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PF04297 UPF0122: Putative helix-turn-helix protein, YlxM / p13 like; InterPro: IPR007394 Members of this family are predicted to contain a helix-turn-helix motif, for example residues 37-55 in Mycoplasma mycoides p13 (O05290 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK09646 RNA polymerase sigma factor SigK; Reviewed | Back alignment and domain information |
|---|
| >TIGR02943 Sig70_famx1 RNA polymerase sigma-70 factor, TIGR02943 family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 390 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-10 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 61.0 bits (147), Expect = 3e-10
Identities = 61/398 (15%), Positives = 110/398 (27%), Gaps = 137/398 (34%)
Query: 32 VDEVLNGQSERCLENF----RM-----DKKVFYKLCDILQSKGLLRHTNRIKIE------ 76
+ V Q+ + F ++ K+V D L + T I ++
Sbjct: 250 LLNV---QNAKAWNAFNLSCKILLTTRFKQVT----DFLSAA----TTTHISLDHHSMTL 298
Query: 77 ---EQLAIFMFIVGHN---LRTRAVQ----------ELFRYSGETIS--RHFN-NVLNAI 117
E ++ + + L + E R T +H N + L I
Sbjct: 299 TPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTI 358
Query: 118 MAISLDFFQPPGPDVPPEISLDPRLY-PYFKDCVGAV--DGIHIPVMV------GVDEQG 168
+ SL+ L+P Y F +V HIP ++ V +
Sbjct: 359 IESSLN-------------VLEPAEYRKMFDRL--SVFPPSAHIPTILLSLIWFDVIKSD 403
Query: 169 P------FRNKSGLLSQNV------LAACSFDLKFHYVLAGWEGSASDLRVLNSALTRRN 216
S L+ + + + +LK + L+ ++ +
Sbjct: 404 VMVVVNKLHKYS-LVEKQPKESTISIPSIYLELKVK---------LENEYALHRSI--VD 451
Query: 217 KLQVPEGKYYLVDNKYANMPGFIAPYQAVSYHTNQTTTGYHPQDAKELFNQRHSLLRNAT 276
+P+ + D + + + G+H ++ + +R +L R
Sbjct: 452 HYNIPK-TFDSDDLIPPYLDQYFYSH-----------IGHHLKNIEH--PERMTLFR--- 494
Query: 277 DRIFGALKERF----------PILLSAPPYPLQTQVKLVVAACALHNYIQREKPDDWLFR 326
+F L RF S Q+K YI P
Sbjct: 495 -MVF--LDFRFLEQKIRHDSTAWNASGSILNTLQQLKF------YKPYICDNDPK----- 540
Query: 327 MYEQDTLLPMAESLLPLEGEQPIVHVDTRALEFGFQTE 364
YE+ L+ LP E I T L E
Sbjct: 541 -YER--LVNAILDFLPKIEENLICSKYTDLLRIALMAE 575
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 390 | |||
| 2w7n_A | 101 | TRFB transcriptional repressor protein; INCP, plas | 95.68 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 95.16 | |
| 2o8x_A | 70 | Probable RNA polymerase sigma-C factor; promoter r | 95.09 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 95.08 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 94.65 | |
| 2jn6_A | 97 | Protein CGL2762, transposase; GFT PSI-2, protein s | 94.34 | |
| 1tty_A | 87 | Sigma-A, RNA polymerase sigma factor RPOD; helix-t | 94.18 | |
| 3hug_A | 92 | RNA polymerase sigma factor; ECF sigma factor, zin | 94.16 | |
| 2p7v_B | 68 | Sigma-70, RNA polymerase sigma factor RPOD; RSD, r | 94.14 | |
| 1ku3_A | 73 | Sigma factor SIGA; helix-turn-helix, transcription | 94.04 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 92.65 | |
| 3t72_q | 99 | RNA polymerase sigma factor RPOD, DNA-directed RN | 92.56 | |
| 1fse_A | 74 | GERE; helix-turn-helix DNA-binding protein transcr | 92.31 | |
| 2jrt_A | 95 | Uncharacterized protein; solution, structure, NESG | 92.3 | |
| 2elh_A | 87 | CG11849-PA, LD40883P; structural genomics, NPPSFA, | 92.27 | |
| 1p4w_A | 99 | RCSB; solution structure, DNA binding domain, DNA | 92.15 | |
| 3c57_A | 95 | Two component transcriptional regulatory protein; | 91.75 | |
| 1je8_A | 82 | Nitrate/nitrite response regulator protein NARL; p | 91.66 | |
| 1s7o_A | 113 | Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP | 91.49 | |
| 2x48_A | 55 | CAG38821; archeal virus, viral protein; 2.60A {Sul | 91.46 | |
| 1wy3_A | 35 | Villin; structural protein; HET: NLE; 0.95A {Synth | 91.07 | |
| 1xsv_A | 113 | Hypothetical UPF0122 protein SAV1236; helix-turn-h | 91.06 | |
| 2jpc_A | 61 | SSRB; DNA binding protein, structural genomics, PS | 90.9 | |
| 1pdn_C | 128 | Protein (PRD paired); protein-DNA complex, double | 90.3 | |
| 1und_A | 37 | Advillin, P92; actin binding, F-actin binding, cyt | 90.21 | |
| 1k78_A | 149 | Paired box protein PAX5; paired domain, ETS domain | 90.16 | |
| 2rn7_A | 108 | IS629 ORFA; helix, all alpha, unknown function, st | 89.91 | |
| 1or7_A | 194 | Sigma-24, RNA polymerase sigma-E factor; regulatio | 89.84 | |
| 1x3u_A | 79 | Transcriptional regulatory protein FIXJ; helix-tur | 89.83 | |
| 3ulq_B | 90 | Transcriptional regulatory protein COMA; tetratric | 89.47 | |
| 2rnj_A | 91 | Response regulator protein VRAR; HTH LUXR-type dom | 89.21 | |
| 1rp3_A | 239 | RNA polymerase sigma factor sigma-28 (FLIA); trans | 88.74 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 88.69 | |
| 1hlv_A | 131 | CENP-B, major centromere autoantigen B; helix-turn | 88.28 | |
| 2lfw_A | 157 | PHYR sigma-like domain; signal transduction, respo | 87.52 | |
| 3frw_A | 107 | Putative Trp repressor protein; structural genomic | 87.1 | |
| 1iuf_A | 144 | Centromere ABP1 protein; riken structural genomics | 86.93 | |
| 3mzy_A | 164 | RNA polymerase sigma-H factor; PSI, MCSG, structur | 85.72 | |
| 2q1z_A | 184 | RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc | 85.71 | |
| 2k27_A | 159 | Paired box protein PAX-8; paired domain, solution | 85.37 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 84.92 | |
| 1j1v_A | 94 | Chromosomal replication initiator protein DNAA, 5' | 84.47 | |
| 3kor_A | 119 | Possible Trp repressor; putative DNA-binding Trp r | 83.5 | |
| 1qzp_A | 68 | Dematin; villin headpiece, actin binding domain, p | 83.17 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 83.01 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 82.86 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 82.86 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 82.48 | |
| 2oa4_A | 101 | SIR5; structure, structural genomics, PSI-2, prote | 82.38 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 82.3 | |
| 1zx4_A | 192 | P1 PARB, plasmid partition PAR B protein, PARB; tr | 82.17 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 82.0 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 81.31 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 81.31 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 80.76 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 80.33 | |
| 1yu8_X | 67 | Villin; alpha helix, 3-10 helix, structural protei | 80.23 | |
| 2qvo_A | 95 | Uncharacterized protein AF_1382; PSI, structural g | 80.02 |
| >2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
Probab=95.68 E-value=0.014 Score=44.94 Aligned_cols=60 Identities=12% Similarity=0.129 Sum_probs=47.3
Q ss_pred CCCHHHHHHHHHHhccCCccccCCCCCHHHHHHHHhhhcccccchhhhhhhcccchhhhhhhhHHHHHHHH
Q 016379 48 RMDKKVFYKLCDILQSKGLLRHTNRIKIEEQLAIFMFIVGHNLRTRAVQELFRYSGETISRHFNNVLNAIM 118 (390)
Q Consensus 48 rms~~~F~~L~~~L~~~~~~~~~~~~~~~~~l~~~L~~L~~~~~~~~l~~~fgis~stv~~~~~~v~~~l~ 118 (390)
|||.+.|+.+...++ ++- ..+-++=.|+-.|.++.++|..+|+|+++|++.+.+.-....
T Consensus 4 rmT~~eFe~~~~~l~----------~~~-~~~~~A~lyYv~g~tQ~eIA~~lGiSR~~VsrlL~~Ar~~~~ 63 (101)
T 2w7n_A 4 RLTESQFQEAIQGLE----------VGQ-QTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFE 63 (101)
T ss_dssp CCCHHHHHHHHTTCC----------CCH-HHHHHHHHHHTTCCCHHHHHHHHTCCHHHHHHHHHHHHHHHH
T ss_pred cCCHHHHHHHHccCC----------hHH-HHHHHHHHHHHcCCCHHHHHHHHCCCHHHHHHHHHHHHHHHh
Confidence 799999999986662 222 334455556677999999999999999999999999877653
|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 | Back alignment and structure |
|---|
| >1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
| >3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B | Back alignment and structure |
|---|
| >1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A | Back alignment and structure |
|---|
| >1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A | Back alignment and structure |
|---|
| >1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} | Back alignment and structure |
|---|
| >1wy3_A Villin; structural protein; HET: NLE; 0.95A {Synthetic} PDB: 1wy4_A 1yri_A* 1yrf_A* 2f4k_A* 1vii_A 3trv_A* 3trw_A 3tjw_B* 3trv_B* 3try_A* 2ppz_A 2jm0_A* 3tjw_A* 3iur_B* | Back alignment and structure |
|---|
| >1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 | Back alignment and structure |
|---|
| >1und_A Advillin, P92; actin binding, F-actin binding, cytoskeleton, headpiece subdomain; NMR {Homo sapiens} SCOP: a.14.1.1 | Back alignment and structure |
|---|
| >1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A | Back alignment and structure |
|---|
| >2rn7_A IS629 ORFA; helix, all alpha, unknown function, structural genomics, PSI-2, protein structure initiative; NMR {Shigella flexneri} | Back alignment and structure |
|---|
| >1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A | Back alignment and structure |
|---|
| >1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A | Back alignment and structure |
|---|
| >2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1sc5_A | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A | Back alignment and structure |
|---|
| >2lfw_A PHYR sigma-like domain; signal transduction, response regulator, sigma factor mimicr sigma factor, general stress response, signaling protein; NMR {Sphingomonas SP} | Back alignment and structure |
|---|
| >3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A | Back alignment and structure |
|---|
| >1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 | Back alignment and structure |
|---|
| >3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} | Back alignment and structure |
|---|
| >2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 | Back alignment and structure |
|---|
| >3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1qzp_A Dematin; villin headpiece, actin binding domain, protein binding; NMR {Homo sapiens} SCOP: a.14.1.1 PDB: 1zv6_A | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >1zx4_A P1 PARB, plasmid partition PAR B protein, PARB; translation; HET: CIT; 2.98A {Enterobacteria phage P1} PDB: 2ntz_A | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1yu8_X Villin; alpha helix, 3-10 helix, structural protein; 1.45A {Gallus gallus} SCOP: a.14.1.1 PDB: 1qqv_A 1yu5_X 2rjx_A 2rjy_A 1yu7_X 2rjv_A 2rjw_A 3nkj_A 3myc_A 3mya_A 3mye_X 1unc_A | Back alignment and structure |
|---|
| >2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 390 | |||
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 96.81 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 95.32 | |
| d1rp3a2 | 71 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 95.27 | |
| d1or7a1 | 68 | SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 | 94.81 | |
| d1s7oa_ | 106 | Hypothetical protein SPy1201 {Streptococcus pyogen | 94.15 | |
| d2jn6a1 | 89 | Uncharacterized protein Cgl2762 {Corynebacterium g | 93.1 | |
| d1k78a1 | 63 | Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | 92.98 | |
| d1xsva_ | 106 | Hypothetical protein SAV1236 {Staphylococcus aureu | 92.58 | |
| d1pdnc_ | 123 | Paired protein (prd) {Fruit fly (Drosophila melano | 91.7 | |
| d1i5za1 | 69 | Catabolite gene activator protein (CAP), C-termina | 91.03 | |
| d1unda_ | 36 | Advillin {Human (Homo sapiens) [TaxId: 9606]} | 90.72 | |
| d1yu8x1 | 35 | Villin {Chicken (Gallus gallus) [TaxId: 9031]} | 90.66 | |
| d1l3la1 | 65 | Quorum-sensing transcription factor TraR, C-termin | 90.38 | |
| d1a04a1 | 67 | Nitrate/nitrite response regulator (NarL) {Escheri | 90.37 | |
| d1ft9a1 | 80 | CO-sensing protein CooA, C-terminal domain {Rhodos | 90.33 | |
| d1fsea_ | 67 | Germination protein GerE {Bacillus subtilis [TaxId | 89.58 | |
| d1yioa1 | 70 | Response regulatory protein StyR, C-terminal domai | 88.67 | |
| d1p4wa_ | 87 | Transcriptional regulator RcsB {Erwinia amylovora | 87.9 | |
| d1ku3a_ | 61 | Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 27 | 87.64 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 87.35 | |
| d2gaua1 | 81 | Transcriptional regulator PG0396, C-terminal domai | 86.98 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 86.65 | |
| d2hsga1 | 57 | Glucose-resistance amylase regulator CcpA, N-termi | 85.87 | |
| d1r1ta_ | 98 | SmtB repressor {Cyanobacteria (Synechococcus), pcc | 85.58 | |
| d1qpza1 | 57 | Purine repressor (PurR), N-terminal domain {Escher | 85.11 | |
| d1aisb2 | 95 | Transcription factor IIB (TFIIB), core domain {Arc | 84.43 | |
| d2zcwa1 | 82 | Transcriptional regulator TTHA1359, C-terminal dom | 84.23 | |
| d2a61a1 | 139 | Transcriptional regulator TM0710 {Thermotoga marit | 83.31 | |
| d1aisb1 | 98 | Transcription factor IIB (TFIIB), core domain {Arc | 83.21 | |
| d1vola2 | 109 | Transcription factor IIB (TFIIB), core domain {Hum | 83.02 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 82.59 | |
| d2p7vb1 | 68 | Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562 | 82.33 | |
| d1uxda_ | 59 | Fructose repressor (FruR), N-terminal domain {Esch | 81.58 | |
| d1efaa1 | 59 | Lac repressor (LacR), N-terminal domain {Escherich | 81.53 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 81.4 | |
| d1qzpa_ | 68 | Dematin {Human (Homo sapiens) [TaxId: 9606]} | 81.0 |
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Recombinase DNA-binding domain domain: HIN recombinase (DNA-binding domain) species: Synthetic
Probab=96.81 E-value=0.0003 Score=44.62 Aligned_cols=35 Identities=11% Similarity=0.159 Sum_probs=32.4
Q ss_pred HHHHHHHhhhcccccchhhhhhhcccchhhhhhhh
Q 016379 76 EEQLAIFMFIVGHNLRTRAVQELFRYSGETISRHF 110 (390)
Q Consensus 76 ~~~l~~~L~~L~~~~~~~~l~~~fgis~stv~~~~ 110 (390)
++|+..+..+++.|.+..+||..||||++|++|++
T Consensus 8 ~~q~~~a~~l~~~G~s~~~iA~~~gVSr~TiYry~ 42 (47)
T d1ijwc_ 8 KHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYF 42 (47)
T ss_dssp HHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHS
T ss_pred HHHHHHHHHHHHCCCCHHHHHHHHCcCHHHHHhhC
Confidence 47888888999999999999999999999999986
|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1unda_ a.14.1.1 (A:) Advillin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yu8x1 a.14.1.1 (X:42-76) Villin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} | Back information, alignment and structure |
|---|
| >d1ku3a_ a.4.13.2 (A:) Sigma70 (SigA, RpoD) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} | Back information, alignment and structure |
|---|
| >d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1qzpa_ a.14.1.1 (A:) Dematin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|