Citrus Sinensis ID: 016388


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP
ccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccHHccccccHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccHHHHHHHHHcccEEEEcccEEEEEEcccccEEEEEEcccEEEEccEEEEcccHHHHHHcccccccccHHHHHHcccccccEEEEEEEcccccccccccEEcccccccccccccccccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEcccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
cccccccccccEcEccccccccccccHHHHHEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHcccccHHHHHccccHHHHcHHHHHHHHHcccEEEEcccEEEEEEccccEEEEEEEEccEEEEEEEEEEEcccHHHHHHccHHHHccHHHHHHHcccccEEEEEEEEEcHHHHHHHHHcccccccccEEEHHHHcccHHHccccccEEEEEEcccccHccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEcccHHHHccccccccccccccccccEEEcccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccc
mifampnkpgefsrfdfpevlpaplNGILAILrnnemltwpEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMrkqgvpdrVTTEVFIAMSKalnfinpdeLSMQCILIALNRFLqekhgskmafldgnpperlcLPIVEHIQSlggevrlnsrvqkielnddgtvknflltngnvidgdayvfatpvdilklqlpeNWKEMAYFKRLEklvgvpviniHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCkeyynpnqSMLELvfapaeewiscsdSEIIDATMKELAKLFpdeisadqSKAKIVKYHVVktprsvyktipncepcrplqrspvegfylagDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGkgrlaeasmcp
mifampnkpgefsrfdfPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKielnddgtvKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKtprsvyktipncepcrplqRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP
MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP
*************RFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARG***********
MIFAM**KPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIV*********************
MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKG*********
MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARG***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query390 2.2.26 [Sep-21-2011]
P28553570 Phytoene dehydrogenase, c yes no 0.994 0.680 0.876 0.0
Q07356566 15-cis-phytoene desaturas yes no 0.994 0.685 0.865 0.0
P80093582 15-cis-phytoene desaturas N/A no 0.994 0.666 0.858 0.0
Q40406570 Phytoene dehydrogenase, c N/A no 0.974 0.666 0.868 0.0
P28554583 Phytoene dehydrogenase, c N/A no 0.994 0.665 0.863 0.0
Q0DUI8578 Phytoene dehydrogenase, c yes no 0.969 0.653 0.867 0.0
A2XDA1578 Phytoene dehydrogenase, c N/A no 0.969 0.653 0.867 0.0
P49086571 Phytoene dehydrogenase, c N/A no 0.982 0.670 0.851 0.0
P26294474 15-cis-phytoene desaturas yes no 0.989 0.814 0.601 1e-134
P29273472 Phytoene dehydrogenase OS N/A no 0.946 0.781 0.615 1e-134
>sp|P28553|CRTI_SOYBN Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Glycine max GN=PDS1 PE=2 SV=1 Back     alignment and function desciption
 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/388 (87%), Positives = 369/388 (95%)

Query: 1   MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAY 60
           MIFAMPNKPGEFSRFDFPEVLP+PLNGI AILRNNEMLTWPEKVKFAIGLLPA++GGQ Y
Sbjct: 182 MIFAMPNKPGEFSRFDFPEVLPSPLNGIWAILRNNEMLTWPEKVKFAIGLLPAMLGGQPY 241

Query: 61  VEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG 120
           VEAQDGL+VQEWM+KQGVP+RV  EVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG
Sbjct: 242 VEAQDGLSVQEWMKKQGVPERVADEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG 301

Query: 121 SKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGD 180
           SKMAFLDGNPPERLC+PIV++IQSLGGEV LNSR+QKIELNDDGTVK+FLL NG V++GD
Sbjct: 302 SKMAFLDGNPPERLCMPIVDYIQSLGGEVHLNSRIQKIELNDDGTVKSFLLNNGKVMEGD 361

Query: 181 AYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSS 240
           AYVFATPVDILKL LP+NWK + YF+RL+KLVGVPVIN+HIWFDRKLKNTYDHLLFSRS 
Sbjct: 362 AYVFATPVDILKLLLPDNWKGIPYFQRLDKLVGVPVINVHIWFDRKLKNTYDHLLFSRSP 421

Query: 241 LLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISAD 300
           LLSVYADMS+TCKEYY+PNQSMLELVFAPAEEWIS SD +II ATM ELAKLFPDEISAD
Sbjct: 422 LLSVYADMSVTCKEYYSPNQSMLELVFAPAEEWISRSDDDIIQATMTELAKLFPDEISAD 481

Query: 301 QSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLS 360
           QSKAKI+KYHVVKTPRSVYKT+PNCEPCRP+QRSP+EGFYLAGDYTKQKYLASMEGAVLS
Sbjct: 482 QSKAKILKYHVVKTPRSVYKTVPNCEPCRPIQRSPIEGFYLAGDYTKQKYLASMEGAVLS 541

Query: 361 GKLCAQAIVQDYVLLAARGKGRLAEASM 388
           GKLCAQAIVQD  LLA RG+ R+A+AS+
Sbjct: 542 GKLCAQAIVQDSELLATRGQKRMAKASV 569




This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene.
Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: 9EC: 9EC: .EC: -
>sp|Q07356|PDS_ARATH 15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=PDS PE=1 SV=1 Back     alignment and function description
>sp|P80093|PDS_CAPAN 15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Capsicum annuum GN=PDS PE=1 SV=1 Back     alignment and function description
>sp|Q40406|CRTI_NARPS Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Narcissus pseudonarcissus GN=PDS1 PE=1 SV=1 Back     alignment and function description
>sp|P28554|CRTI_SOLLC Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Solanum lycopersicum GN=PDS PE=2 SV=1 Back     alignment and function description
>sp|Q0DUI8|CRTI_ORYSJ Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Oryza sativa subsp. japonica GN=PDS PE=2 SV=2 Back     alignment and function description
>sp|A2XDA1|CRTI_ORYSI Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Oryza sativa subsp. indica GN=PDS1 PE=2 SV=2 Back     alignment and function description
>sp|P49086|CRTI_MAIZE Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Zea mays GN=PDS1 PE=2 SV=1 Back     alignment and function description
>sp|P26294|PDS_SYNE7 15-cis-phytoene desaturase OS=Synechococcus elongatus (strain PCC 7942) GN=pds PE=1 SV=1 Back     alignment and function description
>sp|P29273|CRTI_SYNY3 Phytoene dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pds PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
25518260 553 phytoene desaturase (EC 1.14.99.-) 1 - c 1.0 0.705 1.0 0.0
350541925 553 phytoene desaturase [Citrus sinensis] 1.0 0.705 0.994 0.0
350541939 553 phytoene desaturase [Citrus sinensis] 1.0 0.705 0.994 0.0
350541935 553 phytoene desaturase [Citrus x paradisi] 1.0 0.705 0.997 0.0
350541929 553 phytoene desaturase [Citrus x paradisi] 1.0 0.705 0.997 0.0
350541931 553 phytoene desaturase [Citrus x paradisi] 1.0 0.705 0.994 0.0
350541927 553 phytoene desaturase [Citrus sinensis] 1.0 0.705 0.992 0.0
350541937 553 phytoene desaturase [Citrus sinensis] 1.0 0.705 0.994 0.0
13991882 552 phytoene desaturase [Citrus x paradisi] 0.997 0.704 0.997 0.0
190576745 553 phytoene desaturase [Citrus maxima] 1.0 0.705 0.989 0.0
>gi|25518260|pir||JC7723 phytoene desaturase (EC 1.14.99.-) 1 - citrus gi|9757659|dbj|BAB08179.1| phytoene desaturase [Citrus unshiu] gi|18073984|emb|CAC85666.1| phytoene desaturase [Citrus sinensis] gi|82394889|gb|ABB72445.1| phytoene desaturase [Citrus sinensis] Back     alignment and taxonomy information
 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/390 (100%), Positives = 390/390 (100%)

Query: 1   MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAY 60
           MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAY
Sbjct: 164 MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAY 223

Query: 61  VEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG 120
           VEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG
Sbjct: 224 VEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG 283

Query: 121 SKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGD 180
           SKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGD
Sbjct: 284 SKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGD 343

Query: 181 AYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSS 240
           AYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSS
Sbjct: 344 AYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSS 403

Query: 241 LLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISAD 300
           LLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISAD
Sbjct: 404 LLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISAD 463

Query: 301 QSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLS 360
           QSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLS
Sbjct: 464 QSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLS 523

Query: 361 GKLCAQAIVQDYVLLAARGKGRLAEASMCP 390
           GKLCAQAIVQDYVLLAARGKGRLAEASMCP
Sbjct: 524 GKLCAQAIVQDYVLLAARGKGRLAEASMCP 553




Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|350541925|gb|AEQ29518.1| phytoene desaturase [Citrus sinensis] Back     alignment and taxonomy information
>gi|350541939|gb|AEQ29525.1| phytoene desaturase [Citrus sinensis] Back     alignment and taxonomy information
>gi|350541935|gb|AEQ29523.1| phytoene desaturase [Citrus x paradisi] Back     alignment and taxonomy information
>gi|350541929|gb|AEQ29520.1| phytoene desaturase [Citrus x paradisi] gi|350541933|gb|AEQ29522.1| phytoene desaturase [Citrus x paradisi] Back     alignment and taxonomy information
>gi|350541931|gb|AEQ29521.1| phytoene desaturase [Citrus x paradisi] Back     alignment and taxonomy information
>gi|350541927|gb|AEQ29519.1| phytoene desaturase [Citrus sinensis] Back     alignment and taxonomy information
>gi|350541937|gb|AEQ29524.1| phytoene desaturase [Citrus sinensis] Back     alignment and taxonomy information
>gi|13991882|gb|AAK51545.1| phytoene desaturase [Citrus x paradisi] Back     alignment and taxonomy information
>gi|190576745|gb|ACE79168.1| phytoene desaturase [Citrus maxima] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query390
TAIR|locus:2129515566 PDS3 "phytoene desaturase 3" [ 0.994 0.685 0.865 3.1e-186
TAIR|locus:2114789558 ZDS "zeta-carotene desaturase" 0.548 0.383 0.314 2.5e-25
TAIR|locus:2077670488 PAO3 "polyamine oxidase 3" [Ar 0.541 0.432 0.227 5.3e-06
TAIR|locus:2018571497 PAO4 "polyamine oxidase 4" [Ar 0.553 0.434 0.222 9e-05
TAIR|locus:2053723490 PAO2 "AT2G43020" [Arabidopsis 0.523 0.416 0.241 0.00032
TAIR|locus:2129515 PDS3 "phytoene desaturase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1806 (640.8 bits), Expect = 3.1e-186, P = 3.1e-186
 Identities = 336/388 (86%), Positives = 373/388 (96%)

Query:     1 MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAY 60
             MIFAMP+KPGEFSRFDFP+VLPAPLNGI AILRNNEMLTWPEK+KFAIGLLPA++GGQAY
Sbjct:   176 MIFAMPSKPGEFSRFDFPDVLPAPLNGIWAILRNNEMLTWPEKIKFAIGLLPAMVGGQAY 235

Query:    61 VEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG 120
             VEAQDGL+V+EWM KQGVP+RVT EVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG
Sbjct:   236 VEAQDGLSVKEWMEKQGVPERVTDEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG 295

Query:   121 SKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGD 180
             SKMAFLDGNPPERLC+P+V+HI+SLGGEV+LNSR++KIELNDDGTVK+FLLTNG+ ++GD
Sbjct:   296 SKMAFLDGNPPERLCMPVVDHIRSLGGEVQLNSRIKKIELNDDGTVKSFLLTNGSTVEGD 355

Query:   181 AYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSS 240
             AYVFA PVDILKL LP+ WKE+ YFK+L+KLVGVPVIN+HIWFDRKLKNTYDHLLFSRS+
Sbjct:   356 AYVFAAPVDILKLLLPDPWKEIPYFKKLDKLVGVPVINVHIWFDRKLKNTYDHLLFSRSN 415

Query:   241 LLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISAD 300
             LLSVYADMSLTCKEYY+PN+SMLELVFAPAEEWIS +DS+IIDATMKEL KLFPDEISAD
Sbjct:   416 LLSVYADMSLTCKEYYDPNRSMLELVFAPAEEWISRTDSDIIDATMKELEKLFPDEISAD 475

Query:   301 QSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLS 360
             QSKAKI+KYHVVKTPRSVYKTIPNCEPCRPLQRSP+EGFYLAGDYTKQKYLASMEGAVLS
Sbjct:   476 QSKAKILKYHVVKTPRSVYKTIPNCEPCRPLQRSPIEGFYLAGDYTKQKYLASMEGAVLS 535

Query:   361 GKLCAQAIVQDYVLLAARGKGRLAEASM 388
             GK C+Q+IVQDY LLAA G  +L+EA++
Sbjct:   536 GKFCSQSIVQDYELLAASGPRKLSEATV 563




GO:0009507 "chloroplast" evidence=ISM;IDA;TAS
GO:0009536 "plastid" evidence=IEA
GO:0016117 "carotenoid biosynthetic process" evidence=IEA;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0046777 "protein autophosphorylation" evidence=RCA
GO:0016120 "carotene biosynthetic process" evidence=IDA
GO:0016166 "phytoene dehydrogenase activity" evidence=IDA
TAIR|locus:2114789 ZDS "zeta-carotene desaturase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077670 PAO3 "polyamine oxidase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018571 PAO4 "polyamine oxidase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053723 PAO2 "AT2G43020" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A2XDA1CRTI_ORYSI1, ., 1, 4, ., 9, 9, ., -0.86770.96920.6539N/Ano
Q0DUI8CRTI_ORYSJ1, ., 1, 4, ., 9, 9, ., -0.86770.96920.6539yesno
P26294PDS_SYNE71, ., 3, ., 5, ., 50.60150.98970.8143yesno
P28553CRTI_SOYBN1, ., 1, 4, ., 9, 9, ., -0.87620.99480.6807yesno
Q40406CRTI_NARPS1, ., 1, 4, ., 9, 9, ., -0.86840.97430.6666N/Ano
P80093PDS_CAPAN1, ., 3, ., 5, ., 50.85820.99480.6666N/Ano
P28554CRTI_SOLLC1, ., 1, 4, ., 9, 9, ., -0.86340.99480.6655N/Ano
P49086CRTI_MAIZE1, ., 1, 4, ., 9, 9, ., -0.85110.98200.6707N/Ano
Q07356PDS_ARATH1, ., 3, ., 5, ., 50.86590.99480.6855yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.99LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
PLN02612567 PLN02612, PLN02612, phytoene desaturase 0.0
TIGR02731453 TIGR02731, phytoene_desat, phytoene desaturase 0.0
COG3349485 COG3349, COG3349, Uncharacterized conserved protei 1e-98
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 2e-68
TIGR02732474 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot 4e-66
PLN02487569 PLN02487, PLN02487, zeta-carotene desaturase 5e-59
TIGR03467411 TIGR03467, HpnE, squalene-associated FAD-dependent 5e-35
PRK07233434 PRK07233, PRK07233, hypothetical protein; Provisio 7e-14
PLN02268435 PLN02268, PLN02268, probable polyamine oxidase 9e-08
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 1e-04
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 2e-04
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 0.001
COG2509486 COG2509, COG2509, Uncharacterized FAD-dependent de 0.002
>gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase Back     alignment and domain information
 Score =  844 bits (2183), Expect = 0.0
 Identities = 344/388 (88%), Positives = 372/388 (95%)

Query: 1   MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAY 60
           MIFAMPNKPGEFSRFDFPEVLPAPLNGI AILRNNEMLTWPEK+KFAIGLLPAI+GGQAY
Sbjct: 177 MIFAMPNKPGEFSRFDFPEVLPAPLNGIWAILRNNEMLTWPEKIKFAIGLLPAIVGGQAY 236

Query: 61  VEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG 120
           VEAQDGL+V+EWMRKQGVPDRV  EVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG
Sbjct: 237 VEAQDGLSVKEWMRKQGVPDRVNDEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG 296

Query: 121 SKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGD 180
           SKMAFLDGNPPERLC+PIV+H QSLGGEVRLNSR++KIELNDDGTVK+FLLTNG+V++GD
Sbjct: 297 SKMAFLDGNPPERLCMPIVDHFQSLGGEVRLNSRIKKIELNDDGTVKHFLLTNGSVVEGD 356

Query: 181 AYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSS 240
            YV ATPVDILKL LP+ WKE+ YFK+L+KLVGVPVIN+HIWFDRKLKNTYDHLLFSRS 
Sbjct: 357 VYVSATPVDILKLLLPDQWKEIPYFKKLDKLVGVPVINVHIWFDRKLKNTYDHLLFSRSP 416

Query: 241 LLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISAD 300
           LLSVYADMS TCKEYY+PN+SMLELVFAPAEEWIS SD +IIDATMKELAKLFPDEISAD
Sbjct: 417 LLSVYADMSTTCKEYYDPNKSMLELVFAPAEEWISRSDEDIIDATMKELAKLFPDEISAD 476

Query: 301 QSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLS 360
           QSKAKI+KYHVVKTPRSVYKT+PNCEPCRPLQRSP+EGFYLAGDYTKQKYLASMEGAVLS
Sbjct: 477 QSKAKILKYHVVKTPRSVYKTVPNCEPCRPLQRSPIEGFYLAGDYTKQKYLASMEGAVLS 536

Query: 361 GKLCAQAIVQDYVLLAARGKGRLAEASM 388
           GKLCAQ+IVQDY LLAARG  +L+EA++
Sbjct: 537 GKLCAQSIVQDYELLAARGPRKLSEATV 564


Length = 567

>gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase Back     alignment and domain information
>gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information
>gnl|CDD|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase Back     alignment and domain information
>gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase Back     alignment and domain information
>gnl|CDD|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase Back     alignment and domain information
>gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|225307 COG2509, COG2509, Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 390
PLN02612567 phytoene desaturase 100.0
PLN02487569 zeta-carotene desaturase 100.0
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 100.0
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 100.0
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 100.0
PRK07233434 hypothetical protein; Provisional 100.0
PLN02576496 protoporphyrinogen oxidase 99.98
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.98
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 99.98
PRK12416463 protoporphyrinogen oxidase; Provisional 99.97
PRK07208479 hypothetical protein; Provisional 99.97
PRK11883451 protoporphyrinogen oxidase; Reviewed 99.96
COG3349485 Uncharacterized conserved protein [Function unknow 99.96
PLN02268435 probable polyamine oxidase 99.93
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.93
PLN02676487 polyamine oxidase 99.92
PLN02568539 polyamine oxidase 99.92
PLN02529 738 lysine-specific histone demethylase 1 99.91
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.91
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.91
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.91
PLN03000 881 amine oxidase 99.9
PLN02976 1713 amine oxidase 99.9
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.9
PLN02328 808 lysine-specific histone demethylase 1 homolog 99.89
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 99.86
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 99.81
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 99.77
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 99.73
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.69
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.69
COG2907447 Predicted NAD/FAD-binding protein [General functio 99.45
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 99.38
PRK13977576 myosin-cross-reactive antigen; Provisional 98.8
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 98.71
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 98.43
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.1
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 98.05
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.94
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 97.89
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 97.69
PRK10015429 oxidoreductase; Provisional 97.63
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 97.63
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.49
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.48
PRK06847375 hypothetical protein; Provisional 97.42
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.4
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.38
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.33
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.29
COG2081408 Predicted flavoproteins [General function predicti 97.29
PRK07045388 putative monooxygenase; Reviewed 97.28
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.24
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.22
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 97.2
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.15
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.11
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.06
PRK10157428 putative oxidoreductase FixC; Provisional 96.98
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 96.96
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 96.91
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.91
PRK07190 487 hypothetical protein; Provisional 96.85
PRK09126392 hypothetical protein; Provisional 96.84
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 96.82
COG0579429 Predicted dehydrogenase [General function predicti 96.81
PRK08244 493 hypothetical protein; Provisional 96.75
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 96.75
PLN02463447 lycopene beta cyclase 96.74
PRK06834 488 hypothetical protein; Provisional 96.71
PRK07588391 hypothetical protein; Provisional 96.64
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 96.64
PRK06185407 hypothetical protein; Provisional 96.62
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 96.61
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 96.58
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 96.58
PRK06184 502 hypothetical protein; Provisional 96.56
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 96.54
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 96.45
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.44
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 96.41
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.39
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.38
PLN02464 627 glycerol-3-phosphate dehydrogenase 96.32
PLN02697529 lycopene epsilon cyclase 96.25
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 96.22
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 96.2
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 96.18
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 96.15
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.06
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.05
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 96.04
PRK06996398 hypothetical protein; Provisional 96.02
PRK08013400 oxidoreductase; Provisional 96.01
KOG4405547 consensus GDP dissociation inhibitor [Signal trans 95.97
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.93
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 95.75
PTZ00383497 malate:quinone oxidoreductase; Provisional 95.59
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 95.53
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 95.45
PRK06126 545 hypothetical protein; Provisional 95.44
PRK08132 547 FAD-dependent oxidoreductase; Provisional 95.43
PRK08294 634 phenol 2-monooxygenase; Provisional 95.42
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 95.27
PRK11728393 hydroxyglutarate oxidase; Provisional 95.2
PRK05868372 hypothetical protein; Validated 95.16
PRK07121492 hypothetical protein; Validated 95.15
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.09
PRK05257494 malate:quinone oxidoreductase; Validated 95.03
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 95.01
PRK06116450 glutathione reductase; Validated 94.95
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 94.94
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 94.93
PRK08274466 tricarballylate dehydrogenase; Validated 94.88
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 94.88
TIGR00275400 flavoprotein, HI0933 family. The model when search 94.83
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 94.79
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 94.71
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 94.7
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 94.67
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 94.49
PRK11445351 putative oxidoreductase; Provisional 94.44
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 94.43
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 94.43
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 94.4
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 94.33
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 94.27
PRK13339497 malate:quinone oxidoreductase; Reviewed 94.15
PRK06481506 fumarate reductase flavoprotein subunit; Validated 94.12
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 94.09
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 94.08
PRK11259376 solA N-methyltryptophan oxidase; Provisional 94.07
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 93.99
PRK06175433 L-aspartate oxidase; Provisional 93.99
COG4716587 Myosin-crossreactive antigen [Function unknown] 93.97
PRK12839572 hypothetical protein; Provisional 93.92
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 93.9
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 93.84
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 93.79
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 93.77
PRK14989 847 nitrite reductase subunit NirD; Provisional 93.75
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 93.64
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 93.59
PF01134392 GIDA: Glucose inhibited division protein A; InterP 93.58
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 93.51
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 93.45
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 93.32
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 93.26
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 93.25
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 93.2
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 93.15
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 93.15
PRK12842574 putative succinate dehydrogenase; Reviewed 93.14
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 93.13
PRK08275 554 putative oxidoreductase; Provisional 93.1
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 93.09
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 93.07
PLN02507499 glutathione reductase 93.03
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 92.87
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 92.86
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 92.77
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 92.75
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 92.56
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 92.54
PRK07845466 flavoprotein disulfide reductase; Reviewed 92.48
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 92.42
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 92.42
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 92.41
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 92.3
PRK07804 541 L-aspartate oxidase; Provisional 92.22
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 92.19
PRK05976472 dihydrolipoamide dehydrogenase; Validated 92.07
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 92.05
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 91.94
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 91.93
PTZ00318424 NADH dehydrogenase-like protein; Provisional 91.89
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 91.83
PRK09897 534 hypothetical protein; Provisional 91.78
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 91.67
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 91.6
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 91.56
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 91.53
PRK08163396 salicylate hydroxylase; Provisional 91.5
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 91.43
PRK07395 553 L-aspartate oxidase; Provisional 91.41
PRK07512 513 L-aspartate oxidase; Provisional 91.41
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 91.29
PRK08401466 L-aspartate oxidase; Provisional 91.09
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 90.95
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 90.87
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 90.82
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 90.74
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 90.72
PTZ00058561 glutathione reductase; Provisional 90.56
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 90.37
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 90.33
PTZ00052499 thioredoxin reductase; Provisional 90.23
PRK06327475 dihydrolipoamide dehydrogenase; Validated 90.18
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 90.0
PRK06370463 mercuric reductase; Validated 89.96
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 89.8
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 89.79
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 89.74
PRK07236386 hypothetical protein; Provisional 89.69
PRK14727479 putative mercuric reductase; Provisional 89.61
PLN02172461 flavin-containing monooxygenase FMO GS-OX 89.48
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 89.39
PRK09564444 coenzyme A disulfide reductase; Reviewed 89.31
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 89.24
PRK08071 510 L-aspartate oxidase; Provisional 89.03
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 89.02
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 88.88
PLN02546558 glutathione reductase 88.82
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 88.79
PRK10262321 thioredoxin reductase; Provisional 88.76
PLN02985 514 squalene monooxygenase 88.66
PRK14694468 putative mercuric reductase; Provisional 88.58
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 88.57
TIGR02053463 MerA mercuric reductase. This model represents the 88.48
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 88.39
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 88.25
PRK13512438 coenzyme A disulfide reductase; Provisional 88.01
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 87.81
PRK07846451 mycothione reductase; Reviewed 87.29
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 87.15
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 87.06
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 87.05
PRK13748561 putative mercuric reductase; Provisional 87.02
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 86.8
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 86.72
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 86.62
PRK06753373 hypothetical protein; Provisional 86.5
PLN02815 594 L-aspartate oxidase 86.38
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 86.38
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 86.34
PRK09077 536 L-aspartate oxidase; Provisional 85.58
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 85.26
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 85.1
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 85.09
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 84.39
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 84.34
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 84.33
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 84.2
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 84.09
PRK14989 847 nitrite reductase subunit NirD; Provisional 83.39
PRK12831464 putative oxidoreductase; Provisional 83.35
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 83.31
PRK06475400 salicylate hydroxylase; Provisional 83.31
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 82.34
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 82.22
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 82.17
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 82.17
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 81.88
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 81.69
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 81.66
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 81.63
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 81.62
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 81.1
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 80.96
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 80.54
PRK12831464 putative oxidoreductase; Provisional 80.5
>PLN02612 phytoene desaturase Back     alignment and domain information
Probab=100.00  E-value=1.4e-47  Score=379.42  Aligned_cols=386  Identities=89%  Similarity=1.409  Sum_probs=316.3

Q ss_pred             cccCCCCCCcccccCCCCCCCChhhHHHHHcCCCCCCHHHHHHhhhhhHHHHhccccccccccCccHHHHHHHcCCChHH
Q 016388            3 FAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRV   82 (390)
Q Consensus         3 ~~~~~~~g~~~~~~~~~~~~~P~~~~~~ll~~~~~ls~~~k~r~~~~~~~~~~~~~~~~~~~d~~s~~e~l~~~g~~~~~   82 (390)
                      +.+++.++.+.++..+...|.|++.+.++++.++.+++.+|++++..+++......+.+..+|++|+.||+++.++++.+
T Consensus       179 ~~~~~~~~~~~~~~~p~~~P~~l~~~~~~l~~~~~ls~~~kl~~~~~~~~~~~~~~~~~~~~d~~Sv~e~l~~~~~~~~~  258 (567)
T PLN02612        179 FAMPNKPGEFSRFDFPEVLPAPLNGIWAILRNNEMLTWPEKIKFAIGLLPAIVGGQAYVEAQDGLSVKEWMRKQGVPDRV  258 (567)
T ss_pred             EEecCCCCceeeCcCchhcCChhhhhHHHHhcCccCCHHHHHHHHHhhhHHhcccchhhhhcCcCcHHHHHHhcCCCHHH
Confidence            44555567777666553367888888899975578999999998765544322222344568899999999999999999


Q ss_pred             HHHHHHHHHHhccCCCcccccHHHHHHHHHHHhcccCCceEEeecCCCCccchHHHHHHHHHcCcEEEcCceeeEEEECC
Q 016388           83 TTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELND  162 (390)
Q Consensus        83 ~~~~~~p~~~~~~~~~~~~~Sa~~~~~~l~~~~~~~~~~~~~~~~GG~~~~l~~~l~~~l~~~G~~I~l~~~V~~I~~~~  162 (390)
                      .+.+|+|++.++++.+++++|+.+++..+..++...++....++.|+..+.|+++|++.|++.|++|++|++|++|..++
T Consensus       259 ~~~~~~~l~~~~~~~~p~~~S~~~~l~~l~~~l~~~~gs~~~~~~G~~~~~l~~~l~~~l~~~G~~I~l~~~V~~I~~~~  338 (567)
T PLN02612        259 NDEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPIVDHFQSLGGEVRLNSRIKKIELND  338 (567)
T ss_pred             HHHHHHHHHHHhcCCCHHHhhHHHHHHHHHHHHhccCCceEeeecCCchHHHHHHHHHHHHhcCCEEEeCCeeeEEEECC
Confidence            99999999999988999999999999888877665667778888888556899999999999999999999999999876


Q ss_pred             CCCEEEEEEcCCeEEEcCEEEEecChhhHhhhcCcchhccHHHHHhhcCCCccEEEEEEEeCccccccCCceeecCCCcc
Q 016388          163 DGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLL  242 (390)
Q Consensus       163 ~g~v~~V~~~~g~~~~ad~VI~a~p~~~~~~ll~~~~~~~~~~~~~~~l~~~~~~~v~l~~~~~~~~~~~~~~~~~~~~~  242 (390)
                      ++++.+|++.+|++++||+||+|+|+..+..|+++.+.+.++.+.++++.+.++++++++|+++++...+++++.+.+..
T Consensus       339 ~g~v~~v~~~~G~~~~ad~VI~a~p~~~l~~Ll~~~~~~~~~~~~l~~l~~~~v~~v~l~~dr~~~~~~~~~~~~~~~~~  418 (567)
T PLN02612        339 DGTVKHFLLTNGSVVEGDVYVSATPVDILKLLLPDQWKEIPYFKKLDKLVGVPVINVHIWFDRKLKNTYDHLLFSRSPLL  418 (567)
T ss_pred             CCcEEEEEECCCcEEECCEEEECCCHHHHHHhCcchhcCcHHHHHHHhcCCCCeEEEEEEECcccCCCCCceeecCCCCc
Confidence            77665688888988999999999999999999887544446677777888889999999999998755566777666555


Q ss_pred             hhhhhcccccccccCCCCcEEEEEecCCCCCCCCCHHHHHHHHHHHHHHhCCCCccccccCceEEEEEEEEeCCceeccC
Q 016388          243 SVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTI  322 (390)
Q Consensus       243 ~~~~~~s~~~~~~a~~g~~ll~~~~~~~~~~~~~~~ee~~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~a~~~~~  322 (390)
                      +++.+++..+++|++++++++.+++.++++|..++++|+++.++++|+++||....++.....++.+.+.++|.+.|...
T Consensus       419 ~~~~d~S~~~~~~~~~~~~ll~~~~~~a~~~~~~sdeei~e~vl~~L~~lfp~~~~~~~~~~~i~~~~~v~~P~a~~~~~  498 (567)
T PLN02612        419 SVYADMSTTCKEYYDPNKSMLELVFAPAEEWISRSDEDIIDATMKELAKLFPDEISADQSKAKILKYHVVKTPRSVYKTV  498 (567)
T ss_pred             eeehhhhhcchhhcCCCCeEEEEEEEcChhhhcCCHHHHHHHHHHHHHHHCCcccccccCCceEEEEEEeccCCceEEeC
Confidence            55556665556677777788887777778899999999999999999999997632212235677788889999998888


Q ss_pred             CCCCCCCCCCCCCCCCeEEecccccCCCCCchhHHHHHHHHHHHHHHHHhhhhhhhcccccccccC
Q 016388          323 PNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASM  388 (390)
Q Consensus       323 ~g~~~~~~~~~~~~~~l~~aGd~~~~~~~~~~~gA~~SG~~aA~~il~~~~~~~~~~~~~~~~~~~  388 (390)
                      ||....+|..++|++||||||||+.++||++|+||+.||++||++|+++++.+++.+..++++++.
T Consensus       499 pg~~~~rp~~~tPi~~l~lAGd~t~~~~~~smeGAv~SG~~AA~~I~~~~~~~~~~~~~~~~~~~~  564 (567)
T PLN02612        499 PNCEPCRPLQRSPIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQSIVQDYELLAARGPRKLSEATV  564 (567)
T ss_pred             CCCcccCccccCccCCEEEeecceeCCchhhHHHHHHHHHHHHHHHHHHhcccccccccccccccc
Confidence            887767888899999999999999999999999999999999999999999988888888887763



>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query390
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 1e-35
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 1e-22
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 3e-19
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 7e-16
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 6e-15
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 9e-15
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 1e-14
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 4e-14
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 2e-13
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 8e-13
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 8e-13
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 3e-12
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 7e-12
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 2e-11
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 2e-10
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 1e-08
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 2e-06
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 9e-05
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
 Score =  134 bits (339), Expect = 1e-35
 Identities = 39/334 (11%), Positives = 109/334 (32%), Gaps = 32/334 (9%)

Query: 36  EMLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALN 95
           + L+  EK K    LL  I   +     ++ +   EW++++   +     V  + +   +
Sbjct: 101 KFLSVKEKAKAL-KLLAEIRMNKLP---KEEIPADEWIKEKIGENEFLLSVLESFAGWAD 156

Query: 96  FINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRV 155
            ++  +L+   +   +   L          + G   + +   +   I    G++     V
Sbjct: 157 SVSLSDLTALELAKEIRAAL---RWGGPGLIRGGC-KAVIDELERIIMENKGKILTRKEV 212

Query: 156 QKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVP 215
            +I + ++  V      +      D  +    V      +  ++ +  Y K+++ +    
Sbjct: 213 VEINI-EEKKVY---TRDNEEYSFDVAISNVGVRETVKLIGRDYFDRDYLKQVDSIEPSE 268

Query: 216 VINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWIS 275
            I  ++    + +     ++F+   +++ + + S   K       +++    A     + 
Sbjct: 269 GIKFNLAVPGEPRIGN-TIVFTPGLMINGFNEPSALDKSLAREGYTLIMAHMALKNGNVK 327

Query: 276 CSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIP-NCEPCRPLQRS 334
               + I+   +EL ++FP+                    +      P N          
Sbjct: 328 ----KAIEKGWEELLEIFPEGE--------------PLLAQVYRDGNPVNRTRAGLHIEW 369

Query: 335 PVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAI 368
           P+    + GD  +      ++G  L      + +
Sbjct: 370 PLNEVLVVGDGYRPPGGIEVDGIALGVMKALEKL 403


>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 100.0
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.97
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.96
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.96
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.96
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.96
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.96
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.96
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.96
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.96
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.94
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 99.93
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.92
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.91
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.9
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.88
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.88
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.87
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.86
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.85
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.85
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.82
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.78
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.73
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.7
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 99.57
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 99.51
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 99.51
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 99.48
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 99.46
1vg0_A650 RAB proteins geranylgeranyltransferase component A 99.46
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 99.44
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 99.4
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.92
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.04
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.96
3dme_A369 Conserved exported protein; structural genomics, P 97.83
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.78
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 97.69
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 97.69
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.62
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 97.53
3atr_A453 Conserved archaeal protein; saturating double bond 97.5
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.47
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.46
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.4
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.28
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.21
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 97.2
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 97.16
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.16
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.04
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 96.97
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 96.92
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 96.89
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 96.78
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 96.75
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 96.68
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 96.63
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 96.62
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 96.59
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 96.57
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 96.5
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 96.43
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 96.35
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 96.12
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.1
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 96.06
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 96.05
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 96.02
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 95.92
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 95.84
1fec_A490 Trypanothione reductase; redox-active center, oxid 95.83
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 95.82
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 95.79
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 95.76
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 95.76
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 95.72
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 95.72
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 95.68
2ywl_A180 Thioredoxin reductase related protein; uncharacter 95.67
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 95.66
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 95.63
4dna_A463 Probable glutathione reductase; structural genomic 95.56
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 95.56
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 95.55
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 95.45
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 95.45
2cul_A232 Glucose-inhibited division protein A-related PROT 95.39
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 95.34
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 95.33
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 95.27
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 95.25
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 95.24
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 95.15
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 95.07
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 95.06
2gqf_A401 Hypothetical protein HI0933; structural genomics, 95.01
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 94.93
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 94.91
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 94.8
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 94.8
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 94.53
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 94.32
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 94.17
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 94.17
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 94.09
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 94.08
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 94.08
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 94.02
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 93.96
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 93.87
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 93.85
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 93.74
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 93.73
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 93.69
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 93.63
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 93.59
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 93.57
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 93.54
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 93.51
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 93.48
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 93.48
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 93.43
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 93.42
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 93.4
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 93.37
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 93.36
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 93.33
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 93.3
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 93.29
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 93.2
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 93.11
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 93.05
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 93.03
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 92.95
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 92.95
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 92.94
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 92.77
3r9u_A315 Thioredoxin reductase; structural genomics, center 92.74
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 92.73
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 92.7
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 92.69
1ojt_A482 Surface protein; redox-active center, glycolysis, 92.66
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 92.54
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 92.3
4hb9_A412 Similarities with probable monooxygenase; flavin, 92.26
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 92.26
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 92.15
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 92.08
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 92.05
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 91.88
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 91.86
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 91.84
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 91.76
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 91.75
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 91.68
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 91.65
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 91.45
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 91.4
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 91.34
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 91.06
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 91.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 90.84
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 90.75
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 90.74
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 90.67
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 90.61
2bry_A497 NEDD9 interacting protein with calponin homology a 90.58
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 90.47
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 90.38
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 90.36
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 90.31
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 90.17
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 90.15
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 89.99
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 89.98
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 89.92
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 89.88
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 89.77
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 89.7
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 89.65
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 89.46
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 89.33
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 89.25
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 89.23
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 89.2
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 89.15
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 89.07
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 88.62
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 88.44
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 88.39
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 88.16
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 87.67
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 87.6
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 87.5
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 87.1
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 86.99
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 86.92
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 86.57
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 86.52
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 86.2
4fk1_A304 Putative thioredoxin reductase; structural genomic 85.85
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 85.78
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 85.23
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 85.0
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 84.96
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 84.56
2cul_A232 Glucose-inhibited division protein A-related PROT 84.32
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 84.25
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 84.15
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 84.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 83.97
4fk1_A304 Putative thioredoxin reductase; structural genomic 83.95
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 83.71
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 83.53
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 83.53
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 83.31
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 83.29
2ywl_A180 Thioredoxin reductase related protein; uncharacter 81.63
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 81.54
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 81.39
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 81.34
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 81.09
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 80.99
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 80.27
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
Probab=100.00  E-value=1.4e-31  Score=257.83  Aligned_cols=309  Identities=17%  Similarity=0.261  Sum_probs=236.1

Q ss_pred             CCCHHHHHHhhhhhHHHHhccccccccccCccHHHHHHHcCCChHHHHHHHHHHHHhccCCCcccccHHHHHHHHHHHhc
Q 016388           37 MLTWPEKVKFAIGLLPAIIGGQAYVEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQ  116 (390)
Q Consensus        37 ~ls~~~k~r~~~~~~~~~~~~~~~~~~~d~~s~~e~l~~~g~~~~~~~~~~~p~~~~~~~~~~~~~Sa~~~~~~l~~~~~  116 (390)
                      .+++.+|.++...+...    ..  ...+++|+.+|++++ ++++.++.++++++...++.+++++|+.+++..+..+..
T Consensus       112 ~~~~~~~~~~~~~~~~~----~~--~~~~~~s~~~~l~~~-~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~  184 (425)
T 3ka7_A          112 LLSYKDRMKIALLIVST----RK--NRPSGSSLQAWIKSQ-VSDEWLIKFADSFCGWALSLKSDEVPVEEVFEIIENMYR  184 (425)
T ss_dssp             GSCHHHHHHHHHHHHHT----TT--SCCCSSBHHHHHHHH-CCCHHHHHHHHHHHHHHHSSCGGGSBHHHHHHHHHHHHH
T ss_pred             hCCHHHHHHHHHHHHhh----hh--cCCCCCCHHHHHHHh-cCCHHHHHHHHHHHHHHhCCCcccchHHHHHHHHHHHHh
Confidence            57888888876543321    10  234689999999999 889999999999998888889999999988877765432


Q ss_pred             ccCCceEEeecCCCCccchHHHHHHHHHcCcEEEcCceeeEEEECCCCCEEEEEEcCCeEEEcCEEEEecChhhHhhhcC
Q 016388          117 EKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLP  196 (390)
Q Consensus       117 ~~~~~~~~~~~GG~~~~l~~~l~~~l~~~G~~I~l~~~V~~I~~~~~g~v~~V~~~~g~~~~ad~VI~a~p~~~~~~ll~  196 (390)
                       . + ...++.||+ +.|+++|++.++++|++|+++++|++|..+ ++++++|++ +|++++||.||+|+|+..+.+|++
T Consensus       185 -~-~-~~~~~~gG~-~~l~~~l~~~~~~~G~~i~~~~~V~~i~~~-~~~~~gv~~-~g~~~~ad~VV~a~~~~~~~~ll~  258 (425)
T 3ka7_A          185 -F-G-GTGIPEGGC-KGIIDALETVISANGGKIHTGQEVSKILIE-NGKAAGIIA-DDRIHDADLVISNLGHAATAVLCS  258 (425)
T ss_dssp             -H-C-SCEEETTSH-HHHHHHHHHHHHHTTCEEECSCCEEEEEEE-TTEEEEEEE-TTEEEECSEEEECSCHHHHHHHTT
T ss_pred             -c-C-CccccCCCH-HHHHHHHHHHHHHcCCEEEECCceeEEEEE-CCEEEEEEE-CCEEEECCEEEECCCHHHHHHhcC
Confidence             1 1 246899997 899999999999999999999999999985 456766777 478899999999999999999987


Q ss_pred             cch-h--ccHHHHHhhcCCCccEEEEEEEeCccccccCCceeecCC--CcchhhhhcccccccccCCCCcEEEEEecCCC
Q 016388          197 ENW-K--EMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRS--SLLSVYADMSLTCKEYYNPNQSMLELVFAPAE  271 (390)
Q Consensus       197 ~~~-~--~~~~~~~~~~l~~~~~~~v~l~~~~~~~~~~~~~~~~~~--~~~~~~~~~s~~~~~~a~~g~~ll~~~~~~~~  271 (390)
                      +.. .  +.++.+.++++++.+.++++++++++++. ..++++..+  ++.++ ..+|..+|+++|+|++++.+.+....
T Consensus       259 ~~~~~~~~~~~~~~~~~~~~~~~~~v~l~~~~~~~~-~~~~~~~~~~~~~~~~-~~~s~~~p~~ap~G~~~l~~~~~~~~  336 (425)
T 3ka7_A          259 EALSKEADAAYFKMVGTLQPSAGIKICLAADEPLVG-HTGVLLTPYTRRINGV-NEVTQADPELAPPGKHLTMCHQYVAP  336 (425)
T ss_dssp             TTCCTTTTHHHHHHHHHCCCBEEEEEEEEESSCSSC-SSSEEECCSSSSEEEE-ECGGGTCGGGSCTTCEEEEEEEEECG
T ss_pred             CcccccCCHHHHHHhhCcCCCceEEEEeecCCCccC-cCEEEECCChhhcceE-EeccCCCCCcCCCCCeEEEEEecccc
Confidence            431 1  44677788889999889999999998764 344555432  23223 24555778889999998876544221


Q ss_pred             CCCCCCHHHHHHHHHHHHHHhCCCCccccccCceEEEEEEEEeCCceeccCCCCCCCCCCCCCCCCCeEEecccccCCCC
Q 016388          272 EWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYL  351 (390)
Q Consensus       272 ~~~~~~~ee~~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~~~~~~~~~~~l~~aGd~~~~~~~  351 (390)
                      +..+. .+++++.++++|++++|...      .+++  .+.+|+.+.|++.+|+. .++...+|++|||+||||+.+.++
T Consensus       337 ~~~~~-~~~~~~~~~~~l~~~~p~~~------~~~~--~v~~~~~~~P~~~~~~~-~~~~~~~p~~gL~laG~~~~~~gg  406 (425)
T 3ka7_A          337 ENVKN-LESEIEMGLEDLKEIFPGKR------YEVL--LIQSYHDEWPVNRAASG-TDPGNETPFSGLYVVGDGAKGKGG  406 (425)
T ss_dssp             GGGGG-HHHHHHHHHHHHHHHSTTCC------EEEE--EEEEEBTTBCSBSSCTT-CCCCSBCSSBTEEECSTTSCCTTC
T ss_pred             ccccc-hHHHHHHHHHHHHHhCCCCc------eEEE--EEEEECCCccccccccC-CCCCCCCCcCCeEEeCCccCCCCC
Confidence            11122 34567999999999998732      2333  67889999998888854 456778889999999999999777


Q ss_pred             CchhHHHHHHHHHHHHHHH
Q 016388          352 ASMEGAVLSGKLCAQAIVQ  370 (390)
Q Consensus       352 ~~~~gA~~SG~~aA~~il~  370 (390)
                      .+|++|+.||++||++|+.
T Consensus       407 ~gv~~~~~s~~~~~~~i~~  425 (425)
T 3ka7_A          407 IEVEGVALGVMSVMEKVLG  425 (425)
T ss_dssp             CHHHHHHHHHHHHHHC---
T ss_pred             CccHHHHHHHHHHHHHhhC
Confidence            8999999999999999863



>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 390
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 2e-19
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 1e-05
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 2e-04
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 2e-04
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 8e-04
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 87.3 bits (214), Expect = 2e-19
 Identities = 42/380 (11%), Positives = 96/380 (25%), Gaps = 25/380 (6%)

Query: 1   MIFAMPNKPGEFSRFDFPEVLPAPLNGILAILRNNEMLTWPEKVKFAIGLLPAIIGGQAY 60
               +    G+    +  E++    N +L              +                
Sbjct: 85  QKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLN------------NKP 132

Query: 61  VEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHG 120
           V     L V   ++++ V D         +             +           Q K  
Sbjct: 133 VSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEA 192

Query: 121 SKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGD 180
           S++        E L       + +L  E        + +L +          +   +   
Sbjct: 193 SEVKPPRDITAEFLVKSKHRDLTALCKEY-DELAETQGKLEEKLQELEANPPSDVYLSSR 251

Query: 181 AYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSS 240
                                    K  ++         H+         Y  +  + + 
Sbjct: 252 DRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNG----YSCVPVALAE 307

Query: 241 LLSVYADMSLTCKEYYNPNQSMLELVFA-PAEEWISCSDSEIIDATMKELAKLFPDEISA 299
            L +  + ++    Y      ++ +     ++ +I   D+ +    +  L +  P     
Sbjct: 308 GLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFV 367

Query: 300 DQSK-------AKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLA 352
                       ++V          +        P  P    P+   + AG++T + Y A
Sbjct: 368 PPLPEWKTSAVQRMVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPA 427

Query: 353 SMEGAVLSGKLCAQAIVQDY 372
           ++ GA+LSG   A  I   +
Sbjct: 428 TVHGALLSGLREAGRIADQF 447


>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query390
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.25
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.15
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 98.86
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.81
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.52
d2ivda2108 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.5
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.43
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.31
d1seza2112 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.28
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.19
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.08
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.87
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 97.86
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.75
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.65
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.63
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 97.61
d2iida2113 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.51
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.44
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.37
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.36
d2v5za2112 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.33
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.23
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 97.14
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.13
d2dw4a3109 Lysine-specific histone demethylase 1, LSD1 {Human 97.08
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.07
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.03
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 97.03
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 97.02
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.9
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.88
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 96.6
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.57
d1b5qa2112 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 96.53
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.51
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.45
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 96.44
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.31
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.2
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 96.13
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.53
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 95.39
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.92
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 94.59
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.66
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 93.64
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 92.3
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 90.7
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 90.44
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 90.19
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 89.74
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.46
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 88.1
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 88.1
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 87.99
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 87.71
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 86.69
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 86.36
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 85.61
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 85.35
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 85.27
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 85.18
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 84.72
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 84.03
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 83.99
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 83.59
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 82.67
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 82.3
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 81.89
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 80.38
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Monoamine oxidase B
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.25  E-value=4.6e-11  Score=109.01  Aligned_cols=127  Identities=17%  Similarity=0.180  Sum_probs=92.8

Q ss_pred             cccccCccHHHHHHHcCCChHHHHHHHHHHHHhccCCCcccccHHHHHHHHHHH------hcccCCceEEeecCCCCccc
Q 016388           61 VEAQDGLTVQEWMRKQGVPDRVTTEVFIAMSKALNFINPDELSMQCILIALNRF------LQEKHGSKMAFLDGNPPERL  134 (390)
Q Consensus        61 ~~~~d~~s~~e~l~~~g~~~~~~~~~~~p~~~~~~~~~~~~~Sa~~~~~~l~~~------~~~~~~~~~~~~~GG~~~~l  134 (390)
                      ...++..++.+|+.+.+. .+....++..+........+...++..+...+...      ...........+.+++ +.+
T Consensus       135 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~  212 (383)
T d2v5za1         135 AEEWDNMTMKELLDKLCW-TESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGS-GQV  212 (383)
T ss_dssp             HHHHHTSBHHHHHHHHCS-SHHHHHHHHHHHHHHHSSCTTTSBHHHHHHHHHTTTCHHHHHCSTTSTTSEEETTCT-HHH
T ss_pred             hhhhhhhHHHHHHHHhcc-chHHHHHHHHhhhhhhccccchhhHHHHHHHHHhhcccccccccccCcceeeeccch-hHH
Confidence            345678899999999844 44556677777776666778888888776654321      1111122345677886 788


Q ss_pred             hHHHHHHHHHcCcEEEcCceeeEEEECCCCCEEEEEEcCCeEEEcCEEEEecChhhHhhh
Q 016388          135 CLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQ  194 (390)
Q Consensus       135 ~~~l~~~l~~~G~~I~l~~~V~~I~~~~~g~v~~V~~~~g~~~~ad~VI~a~p~~~~~~l  194 (390)
                      ++++++   +.|++|++|++|++|..+++ .+ .|++.||++++||+||+|+|+..+.++
T Consensus       213 ~~~l~~---~~g~~i~~~~~v~~I~~~~~-~v-~v~~~~g~~~~ad~vI~a~p~~~~~~~  267 (383)
T d2v5za1         213 SERIMD---LLGDRVKLERPVIYIDQTRE-NV-LVETLNHEMYEAKYVISAIPPTLGMKI  267 (383)
T ss_dssp             HHHHHH---HHGGGEEESCCEEEEECSSS-SE-EEEETTSCEEEESEEEECSCGGGGGGS
T ss_pred             HHHHHH---HcCCeEEecCcceEEEecCC-eE-EEEECCCCEEECCEEEECCCHHHHhhC
Confidence            888875   45899999999999998644 46 488999999999999999998766554



>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure